KEGG   Novosphingobium aromaticivorans: Saro_1820Help
Entry
Saro_1820         CDS       T00322                                 

Definition
(GenBank) Dimethylaniline monooxygenase (N-oxide forming)
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1919909..1921273)
Genome map
AA seq 454 aa AA seqDB search
MTQLPRVCIIGAGCSGFTTAKCLQDYGIPFVVYEASDDIGGNWYFNNPNGMSACYQSLHI
DTSKWRLAFEDFPVPAEWPDYPHHAQLLQYFHGYVDHFDLRPHIRFNTRVEKATRRDDGG
WKIRLSTGEVERFDALVVANGHYWAARIPEYPGHFDGPQIHSHAYRSPFDPIDCVGKRVL
VVGMGNSAMDIASELSQRPIASRLFVSTRRGVWVLPKYYRGQPLDKNPAPAWMPKGLRNW
IATRMIKKLVGRMSQYGLPEPEIGPFESHGTVSGEFLLRAGSGDIAMKPGIERLDGNAVI
FSDGTREEIDAIVWATGYDIRFPFFDDPELVADADNRPPPLYKRILKPGMPDLFYVGLAQ
PLPTLVNFAEQQSKLVAAYLAGQYAPPPPDEMHRIIAEDEAYYTGQYYAARRHTIQLDFD
HYVRALKKELAAGSKRAKASGGALPVLPRNLEPA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacccagttgccgcgcgtctgcatcatcggggccggctgctccggtttcaccaccgcc
aagtgcctgcaggattacggcatccccttcgtcgtctacgaagcctcggacgacattggc
gggaactggtatttcaacaaccccaacggcatgtcggcctgctaccagagcctgcacatc
gacacgtcgaagtggcgcctggcgttcgaggacttccccgtcccggccgaatggcccgat
tacccgcaccacgcacagcttctccaatacttccacggctacgtcgatcatttcgacctg
cgcccgcacatccgcttcaacacgcgggtcgaaaaggccacgcgccgcgacgatggcggc
tggaagatcaggctgtcgaccggagaagtggagcggttcgacgcactggtcgtcgccaac
ggccattactgggccgcacgcattcccgaataccccggccatttcgacgggccgcagatc
cacagccacgcctatcgcagcccgttcgacccgatcgattgcgtgggcaagcgcgtgctc
gtcgtcggcatgggcaatagcgcgatggacatcgcctccgagctttcccagcgtccgatc
gcctcgcgcctgttcgtatcaacgcggcgcggggtgtgggtactgcccaagtactatcgc
ggccagcccctcgacaagaacccggcgcccgcatggatgccaaagggcctccgcaactgg
atcgccacacggatgatcaagaaactggtcggccgcatgagccagtacggcctgcccgaa
cccgagatcggcccgttcgaaagccacggcaccgtctccggcgagtttctgctgcgcgcg
ggatctggcgacatcgccatgaaacccggcatcgaaaggctcgacggcaatgcagtcatc
ttctctgacggtacgcgcgaggagatcgacgcgatcgtgtgggcgacgggctacgacatc
cgctttccgttcttcgacgatcccgagcttgtggccgatgccgacaaccgcccgcctccg
ctatacaagcggatactcaagccgggcatgcccgacctgttctacgtcggtctggcccag
cctctgccgacgctcgtcaatttcgcagagcagcagtcaaagctggtggcggcctatctt
gcggggcaatacgcgccgccaccgccggacgagatgcaccgcatcattgccgaggacgag
gcctactacaccgggcaatactacgcggcccggcggcacacgatccagctcgatttcgat
cattatgtcagggcgttgaaaaaggaacttgcagcgggttccaaacgggcaaaggcatcg
ggcggcgcgcttccggttctgccccgcaacctcgagcccgcctga

DBGET integrated database retrieval system