KEGG   Novosphingobium aromaticivorans: Saro_1841Help
Entry
Saro_1841         CDS       T00322                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nar00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1940747..1941853
Genome map
AA seq 368 aa AA seqDB search
MLKVYIRPIALADSPQSEEGEAIRLGGGLVYASRFALIVRDGARVVSRRRFSVPEVSRAF
GALPDGLAAEAAAQWDNLRRVHQPIGCGQRMLRLDQPQVMGILNVTPDSFSDGGKFLDRP
ETALEHAHAMLAAGAALIDVGGESTRPGAAAVWEGDEAKRVVPVIEALAASGAAISIDSR
RSTVIEAALAAGAHIVNDVSAMRHDPRTAEIVAASGAPVVLMHAPGSDGDLHADGEYADV
VLDVFDALRERRDAALAGGIAPEKILLDPGIGFGKSLAENLALVNALPMFHALGHPILFG
ASRKRMIGALSNEAPAHQRMAGSVMLALKAMDAGCQMVRVHDVAETVQALHVWRGLRDAA
LTDFSQLA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtctacattcgtccgatcgcgctggccgacagcccccagtcggaggaaggc
gaggccatccgtctagggggcgggctggtctatgcaagccgcttcgcgctgatcgtccgc
gacggcgcgcgggtcgtgtcgcgccgccgattttcggtgcccgaagtttcgagagctttt
ggcgccctgccggatggccttgccgcagaagctgcggcccagtgggacaacctgcgccgc
gtccatcagccgattggctgtggccagcgcatgctgcggctcgaccagccgcaggtcatg
ggcattctcaacgtaacgcccgacagcttctccgacgggggcaagttcctcgacaggccc
gagactgcgctcgaacacgctcacgcgatgcttgcggcgggcgcggcgctgatcgacgtc
ggcggggaatcgacccgccccggcgccgccgccgtctgggaaggcgacgaggcgaagcgc
gtggtcccggtcatcgaggccctggccgcttccggcgccgcgatctcgatagacagtcgc
cgatctacggtgatcgaggcggcgcttgccgcaggcgcacacatcgtcaacgacgtttcg
gcaatgcgccacgatccgcgcacggcggaaatcgtggccgccagcggtgcgccggtcgtg
ctgatgcatgcgccaggaagcgacggcgacctccatgccgatggcgaatatgcggatgtg
gtgctcgacgtcttcgatgccttgcgcgaacggcgcgacgcggcgctagccggcgggatc
gctcccgagaagatccttctcgatccgggcatcggcttcggcaagtcgctcgcggagaat
ctggcgctggtgaacgccctgccgatgttccacgcgctgggccacccgatccttttcggg
gcgagccgcaagcgcatgatcggcgcgctatccaacgaggcgccggcgcaccagcgcatg
gctggttcggttatgctggcgctgaaggcgatggacgccggatgccagatggtccgcgtt
cacgatgtggccgagacggttcaggccctgcatgtctggcgcgggctgcgcgacgcggcg
ttgacggatttcagccaactggcctga

DBGET integrated database retrieval system