KEGG   Novosphingobium aromaticivorans: Saro_1878Help
Entry
Saro_1878         CDS       T00322                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Saro_1878
  Lipid metabolism
   00561 Glycerolipid metabolism
    Saro_1878
   00600 Sphingolipid metabolism
    Saro_1878
Enzymes [BR:nar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Saro_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1979797..1981896
Genome map
AA seq 699 aa AA seqDB search
MGEVFALHSGDGSLVWEADDGSAPAWRHFGPRLTADGIRPIRDQRAPASYSLDDDVPFAV
APAAGLGWFGPSAMCLRRGSVALVPAMAGASVAGDAGSVRIITRDPVAGVELEQVFEAVG
GAFVCRSVVRNIGSETFEVDWLSSALLPIAGSAREIVSWRGRHNAELVECREPMPQHSWV
REGRRGISGHGGPPGLFVLDEGATYHAGTVRALQLAWSGDARIEVERDDEGFWTLNAGAV
LQPGEASLAPGESWQSPDAIVTVSTSGRNGAAQAFHDAVRARIRWPDGAMRPRPVHLNSW
EACYFDHDEERIVALAEAAASVGVERFILDDGWFRGRNDDTAGLGDWTTDPVKYPHGLRT
LADRVNALGMEFGLWVEPEMINPDSDLYRAYPDWALALPGRKRPTARNQLVLDMRRRDVR
DHLFGCIDALLRELPITYLKWDHNRDLAPAGGAAQMRGAYELFARVRAAHPAVEIEACAG
GGGRNDAGMADYCHRYWTSDNIDAASRIGIQRGFLSFLPPEVMGSHIAASPAHATGRRHS
LGFRAAMAMAGHLGVEMDPRTLGDAERAELADWIAFHKQWRGLLHQGTVWLGEGADAAFW
QAQGNAAELLLFVIRADPPLDRRPQPLPLPFAGQDGTWDIRLLRIAGGEGGHAAHSAALF
EAMKAAPQAFPADWLSANGLPLPPCKAETVTIFHLRKRA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggtattcgccttgcactccggggacggcagtctcgtctgggaagcggacgac
ggcagcgcgcccgcgtggcggcacttcggcccccggctgacagccgacgggatccggccg
atccgggaccagcgcgcgcctgcgtcatactcgctggacgacgacgtaccgttcgccgtc
gcaccggcggccgggctgggctggttcggaccttcggccatgtgcttgcggcgcggctca
gtcgcactcgtgccggcaatggcgggggcgtccgtcgccggggatgccggctccgtgcgc
atcatcacgcgcgatccggttgcgggcgtggagcttgaacaggtgttcgaagcagttggc
ggtgctttcgtctgccgcagcgtcgtgcgcaacatcggcagtgaaacgttcgaggtcgac
tggctgtcgagcgcgctcctccccatcgcgggttccgcgcgcgagatcgtgtcgtggcgt
ggacgccacaacgccgaactggtcgaatgccgcgagccgatgccgcagcattcgtgggtg
cgcgaaggtcggcgcgggatttccgggcacggcggccctccgggcctgttcgtgctcgac
gaaggcgctacgtatcacgcgggcactgtccgcgcgctgcagcttgcgtggtctggcgat
gcgcgcatcgaggtcgagcgcgacgacgagggtttctggacgttgaacgcgggcgcggtg
cttcaacctggcgaggccagccttgcgcccggcgagagctggcagtcgcccgacgccatc
gtgacggtatcaacctccggccggaacggcgcggcgcaggcgtttcacgatgcagtccgc
gcgcgcatccgctggccggacggggccatgcgcccacggcccgtgcacctcaactcgtgg
gaagcctgctatttcgaccacgacgaggagcgcatcgttgcccttgcggaagcggcggca
tccgtgggcgtggagcggttcattctcgacgatggctggttccggggccgcaacgacgac
acggcgggactgggcgactggacaaccgatcccgtcaagtatccgcacggactgcgcacc
ctggcagaccgcgtcaatgcgctgggcatggagttcgggctctgggtcgaaccggaaatg
atcaatcccgatagcgacctctatcgggcgtatccggactgggcgcttgcgcttccgggg
cggaaacgaccgactgcccggaaccagctcgtgcttgacatgcggcgacgggacgttcgc
gaccacctcttcggctgcatcgacgcgctgctgcgcgaattgccgatcacctacctcaag
tgggaccacaaccgcgacctcgcgcctgctggcggggcggcgcagatgaggggggcgtat
gaactgttcgcgcgggtccgcgcagcgcatcccgccgtggagatcgaggcctgtgctggc
ggcggcgggcgcaacgatgcaggtatggccgactattgccatcgctactggaccagcgac
aatatcgacgcggccagtcgcatcggtatccagcgcgggttcctgtcgttcctccctccc
gaggtgatgggatcgcacatcgccgcaagccccgcccatgccacggggcgcaggcattcc
ctgggcttccgggctgccatggcgatggccggtcatctcggcgtggaaatggacccgcgc
acgctgggcgatgcagagcgcgccgaactggccgactggatcgcctttcacaagcaatgg
cgcggattgctgcaccagggcactgtctggctgggcgagggtgcggatgcagcgttctgg
caggcgcaggggaatgcagcggaactgctgctcttcgtgatccgcgcggacccgccgctg
gaccgtcgcccgcagcctttgccactgcctttcgcgggccaggatggaacatgggacatc
cggcttcttcgtatcgccgggggcgagggcgggcatgccgcgcattccgctgcgctgttc
gaggcaatgaaggccgcccctcaggcgttcccggctgactggctctcggccaacggcctg
ccgctcccgccctgcaaggcggagacggtcaccatcttccatctgcgcaaacgcgcctga

DBGET integrated database retrieval system