KEGG   Novosphingobium aromaticivorans: Saro_1896Help
Entry
Saro_1896         CDS       T00322                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saro_1896
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1896
   00052 Galactose metabolism
    Saro_1896
   00500 Starch and sucrose metabolism
    Saro_1896
   00520 Amino sugar and nucleotide sugar metabolism
    Saro_1896
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Saro_1896
   00524 Butirosin and neomycin biosynthesis
    Saro_1896
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Saro_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2009128..2010096
Genome map
AA seq 322 aa AA seqDB search
MQVVAVDIGGTHARFAIAEVAEGRVVSLGEAVTLKTAEHGSFQLAWEDFERVRGEPLPKA
AAIAVAGPVGGEIIKFTNNPWIIRPALIPEKLGAEQYVVVNDFAAVAHAVAQADQSHFLH
LSGPDEPLPASGVTSVVGPGTGLGVAQLWRDGNNYRVQPTEGGHIDFAPLDSIEDAILAG
LRKRHRRVSAERVVAGPGIVDIYEALALIEGRPFTPRSDRELWELGTSGADSLAAAAVDR
FCLSLGSVAGDLALAHGANGVVMAGGLGLRIKDTLVRSGFSDRFRAKGRFEALMAAIPVK
LITHPQPGLFGAAAAFAQAHTS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagttgccgtcgatattggcggaacccacgcccgcttcgcgattgccgaagtc
gcggaaggccgcgtggtctcgcttggcgaggccgttacgctcaagacggcggagcatggc
tcgttccagcttgcctgggaggatttcgagcgcgttcgtggagagccattgcccaaggcc
gcggctattgccgtcgccgggcctgtcggcggcgagatcatcaagttcacgaacaatccg
tggatcatccgcccggcgttgatcccggagaagctgggggcggagcaatatgtcgtcgtc
aacgacttcgccgccgtggcccatgctgtcgcgcaggcggaccagagccactttctacac
ctgagcggcccggacgaaccgctgcccgccagcggcgtgaccagcgtggtcggaccaggg
acagggctcggcgtggcgcagttgtggcgtgacgggaacaactaccgggtccagcccacc
gaaggcgggcacatcgacttcgcgccgctagattcgatcgaggacgcgatccttgccggt
ctgcgcaagcgccaccgccgcgtttcggcggaacgcgtcgtggccgggccgggcatcgtc
gatatctacgaggcgcttgctctgatcgaaggacgaccgtttacaccccggtctgaccgc
gagttgtgggaactcgggacttccggagcggacagccttgccgccgctgcagtagacagg
ttctgcctctcgctcggcagcgtggcaggcgatcttgccctggctcacggcgccaacggc
gtcgtcatggccggcgggcttggcctgcggatcaaggacacgctggttcggtctggcttc
tcggacaggttcagggcaaaagggcggttcgaggccctcatggcggccattccggtcaag
ctgatcacgcatccgcagcccggcctgttcggtgcggcagcggcctttgcgcaagcgcat
acgtcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system