KEGG   Novosphingobium aromaticivorans: Saro_1896Help
Entry
Saro_1896         CDS       T00322                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00052  Galactose metabolism
nar00500  Starch and sucrose metabolism
nar00520  Amino sugar and nucleotide sugar metabolism
nar00521  Streptomycin biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01200  Carbon metabolism
Module
nar_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1896
   00052 Galactose metabolism
    Saro_1896
   00500 Starch and sucrose metabolism
    Saro_1896
   00520 Amino sugar and nucleotide sugar metabolism
    Saro_1896
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Saro_1896
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Saro_1896
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Saro_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABD26336
UniProt: Q2G737
Position
2009128..2010096
Genome map
AA seq 322 aa AA seqDB search
MQVVAVDIGGTHARFAIAEVAEGRVVSLGEAVTLKTAEHGSFQLAWEDFERVRGEPLPKA
AAIAVAGPVGGEIIKFTNNPWIIRPALIPEKLGAEQYVVVNDFAAVAHAVAQADQSHFLH
LSGPDEPLPASGVTSVVGPGTGLGVAQLWRDGNNYRVQPTEGGHIDFAPLDSIEDAILAG
LRKRHRRVSAERVVAGPGIVDIYEALALIEGRPFTPRSDRELWELGTSGADSLAAAAVDR
FCLSLGSVAGDLALAHGANGVVMAGGLGLRIKDTLVRSGFSDRFRAKGRFEALMAAIPVK
LITHPQPGLFGAAAAFAQAHTS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagttgccgtcgatattggcggaacccacgcccgcttcgcgattgccgaagtc
gcggaaggccgcgtggtctcgcttggcgaggccgttacgctcaagacggcggagcatggc
tcgttccagcttgcctgggaggatttcgagcgcgttcgtggagagccattgcccaaggcc
gcggctattgccgtcgccgggcctgtcggcggcgagatcatcaagttcacgaacaatccg
tggatcatccgcccggcgttgatcccggagaagctgggggcggagcaatatgtcgtcgtc
aacgacttcgccgccgtggcccatgctgtcgcgcaggcggaccagagccactttctacac
ctgagcggcccggacgaaccgctgcccgccagcggcgtgaccagcgtggtcggaccaggg
acagggctcggcgtggcgcagttgtggcgtgacgggaacaactaccgggtccagcccacc
gaaggcgggcacatcgacttcgcgccgctagattcgatcgaggacgcgatccttgccggt
ctgcgcaagcgccaccgccgcgtttcggcggaacgcgtcgtggccgggccgggcatcgtc
gatatctacgaggcgcttgctctgatcgaaggacgaccgtttacaccccggtctgaccgc
gagttgtgggaactcgggacttccggagcggacagccttgccgccgctgcagtagacagg
ttctgcctctcgctcggcagcgtggcaggcgatcttgccctggctcacggcgccaacggc
gtcgtcatggccggcgggcttggcctgcggatcaaggacacgctggttcggtctggcttc
tcggacaggttcagggcaaaagggcggttcgaggccctcatggcggccattccggtcaag
ctgatcacgcatccgcagcccggcctgttcggtgcggcagcggcctttgcgcaagcgcat
acgtcgtga

DBGET integrated database retrieval system