KEGG   Novosphingobium aromaticivorans: Saro_2024Help
Entry
Saro_2024         CDS       T00322                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nar01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nar00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2157759..2158547
Genome map
AA seq 262 aa AA seqDB search
MTDKLTEICDTKRNEVAARKGAVTVSELTARASEQSAPRGFEKALRGKAAEGFALIAEIK
KASPSKGLIRPDFRPADHARAYQAGGAACLSVLTDAPYFQGHEDFLVEARAACTLPVIRK
DFMVDPWQCLEARAIGADAILIIVAALSDQQMAEIEAAALEQGMDALVEVHNEEEMERAA
RLRSRLIGVNNRDLKRFVTDLATTERLAPLAPDGTLLVAESGINTHADLLRLEKCGARTF
LVGESLMRQADVEAATRGLLFG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagctcaccgaaatctgcgataccaagcgcaatgaagtcgccgcccgcaag
ggcgctgtcaccgtcagcgaactcaccgcccgcgccagcgaacagagcgcgccgcgcggc
ttcgaaaaagccctgcgcggcaaggccgccgaaggcttcgcgctcatcgccgaaatcaag
aaggccagcccctccaagggtctgatccgcccggatttccgtccggccgatcacgcccgc
gcctatcaggccggcggcgcggcctgcctctcggtcctcaccgatgcaccctatttccag
ggccacgaggatttcctcgtcgaagcgcgcgcagcctgcacgctcccggtgatccgcaag
gatttcatggtcgatccatggcagtgccttgaagcgcgcgccatcggcgccgacgccatc
ctcatcatcgtcgccgccctgtccgaccagcagatggccgaaatcgaggccgcggccctc
gaacagggcatggatgcacttgtcgaagtccacaacgaggaagagatggagcgcgccgcc
cgcctgcggtcgcgcctgatcggggtcaacaaccgcgatctcaagcgcttcgtgaccgac
ctcgccacgaccgaacgcctcgcccccctcgctccggatggcaccctgctggttgccgaa
agcggtatcaacacccacgccgacttgcttcgcctcgaaaagtgcggcgcccgcacgttt
ctcgtcggcgaaagcctgatgcgccaggccgacgtcgaagcggcaacgcgcggactgttg
ttcggttag

DBGET integrated database retrieval system