KEGG   Novosphingobium aromaticivorans: Saro_2160Help
Entry
Saro_2160         CDS       T00322                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nar  Novosphingobium aromaticivorans
Brite
Enzymes [BR:nar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Saro_2160
Secretion system [BR:nar02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Saro_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2298519..2299433
Genome map
AA seq 304 aa AA seqDB search
MIENTLLEQDNRRRRWLRTSAGLAAIIAMSAATGWGVASLAAPAAAPDTAKVREALKLRL
PKTPIDAINCKGLGGLCEVASKSTLFYVDRAAKYLVIGRVYDMEARQDLTAARLLALNPD
LLASGAARRSNPETQAEADPPPAAASARNSPPRHVPLGKLPAKGAITWGPANGPRVVVFS
DFHCGYCKKLEAELKAIGARVEERPISIFGAESRRDAERVLCSPRPELALHMAYSGLALA
NPKPCDTSGLDANEAFARAHGFGGTPVIVRPADGAVLEGFRPAAVLRDFLRAGPSLTPTP
APKG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaaatactctcctcgagcaggacaatcgtcggcgccgctggttgcgtaccagc
gccggactggcggcgatcatcgccatgtcggccgcgacgggatggggtgtggcaagcctt
gctgcccctgctgccgctccggacacggcgaaagttcgagaggcgctcaagctgcgcctg
cccaagacgccgatcgacgcgatcaactgcaagggccttggcggcctgtgcgaggtcgcg
tccaaatcgacgctcttctacgtcgaccgggctgcaaagtatctggtaatcggccgggtc
tacgacatggaagcccgtcaggatctgacggccgcccgattgcttgccctcaatcccgac
ctgttggcatcgggagcagcgcggcgcagcaatcccgagacgcaagcagaagccgatcca
ccccccgctgcagcgtcagcccggaactccccgccgcgccatgtcccgctcggcaagctt
cccgccaaaggcgcgatcacctggggtcctgccaatggtccgcgcgtcgttgtcttctcg
gacttccactgcggctattgcaagaagctcgaggccgaattgaaggcgatcggagcgcgg
gttgaagagcggccgatctcgatcttcggggccgaaagccggcgcgatgctgaacgggtt
ctgtgctcgccccggcctgagctggcgctgcatatggcctattcgggtctggcgctcgcc
aatcccaaaccctgcgacacgagcggtctcgatgccaacgaggccttcgcgcgggcccac
ggttttggcggcacccctgtgatcgtgcgccccgccgatggcgccgttctcgaaggcttc
cggcctgccgctgtgctccgggacttcctgcgcgctggcccctccctgacccccacccct
gctcccaaaggatag

DBGET integrated database retrieval system