KEGG   Novosphingobium aromaticivorans: Saro_2424Help
Entry
Saro_2424         CDS       T00322                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Saro_2424
  Lipid metabolism
   00600 Sphingolipid metabolism
    Saro_2424
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Saro_2424
Enzymes [BR:nar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Saro_2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2606887..2609781)
Genome map
AA seq 964 aa AA seqDB search
MSGLRRREVLGAGLIAGTLPLMPPAVARTASDVEESPLLHGLAPRDDTPWALPQHDPSRL
LLDEGWRFHEGDVVVPPPASHHETYLSVKAGNARGAAAMAWDDSDWPVVRVPHDWASAQP
FVREANVSQGYRPRGIGWYRRTFRLAEADRGKRLELQFGGVATACQIWINGSLVARNSSA
YNAINIDITPFARFGEEDNVIAVRVDADALEGWWYEGAGIYRHVWLARRSGVSIATDGVH
CDPRLVDGRWWVPVTVTLESVEKLARTVTVTAVLRDGAGREVARGEAHAQVEPLGRAEAR
VTLEVGNPALWSVETPTLYEVEITAGHLDGMDLRRVPVGFRTIRFDAEKGFFLNDKPVKL
KGVCLHQDHAGVGVAIPDALLAWRLARLKDMGCNAIRCSHNAQSEAFYALCDRIGFLVMD
ENRVFNPAPENMAQLEWLVRAHRNHPSIVLWSVFNEEPMQGTTQGVEMVRRMRAAVRALD
DSRPVTAAMNGAFHDPVNVSQVVDVVGFNYYPGDFDRFHAEHPDLPITSSEDTSAFMTRG
AYASDPAGHVITSMDKEAAAWGATHRDAWREIARRPFVAGGFVWTGFDYHGEPTPYDWPT
ISSYFGIVDLCGFAKTAYDIRRAQWIDDRPVVGIAPHWTWPGREGQEIELLVTSNAGRVR
LRLNGRVVAEQDCDPIMGATVRTIYEPGVIEAEALRGGEVVARAIHRTAGKPVALRLTPT
RKSLRGDGEDVAAFTVDCVDARGLHVPTADARVRLGVVRGTVLGLGNGDPNSHESEKGNE
RSLFNGLAQVIVRADAGEGSLAVEASAPGLRSARASVPVRQVSPPPALAAALPRIVVADW
RCSPAYAERPDPALRPADGDNNLWAFVRTPWVAADDTQPGWRILRGVIPARRALATRGGQ
LQFDRVAGVAELWIDGALAVRKGTPDPAPMTVALKPGAREIALLVRSGPGVPSGIAGAVR
VTTN
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcttcgccgccgggaggttctcggcgcgggcctgatcgcgggcacgctcccg
ctgatgccacctgccgtggcacgaactgcctccgacgtcgaggaatcaccgctccttcat
ggccttgccccccgcgacgatacgccctgggccttgccgcagcacgatccgtcgcggctg
cttctggacgaaggctggcgctttcacgaaggcgatgtcgtcgtgccgcccccggccagc
catcacgagacatatctctccgtaaaggctggcaatgcgcgcggcgccgcagccatggct
tgggacgacagtgactggcctgtggtgcgtgtgccccacgattgggcctccgcgcagccc
ttcgtgcgcgaagccaatgtgtcgcagggctatcgtccgcgcgggatcggctggtatcgc
cgcacgttcaggctggcggaagccgaccggggcaagcggctggaactgcaattcggcggc
gtcgccacggcctgtcagatctggatcaacggcagcctcgttgcgcgcaacagttccgcc
tacaacgccatcaacatcgatatcacccccttcgcccgctttggcgaggaggacaacgtg
atagccgtgcgcgtcgatgccgatgcgctggaaggctggtggtacgagggcgcgggcatc
tatcgccatgtctggcttgcgcgccgctccggggtctcgattgctaccgacggggtgcac
tgcgatccccggcttgtcgacgggcgctggtgggtgccggtcactgtgacgctggaaagc
gtcgagaagcttgcccggacggtcacggtcaccgccgtcctgcgcgacggcgcgggccgc
gaggtcgcgcgcggggaggcccatgcccaggtcgagccgctggggcgggcggaagcgcgg
gtgacgctggaagtgggcaatcccgccctgtggtccgtggaaacgccgaccctctacgaa
gtggagatcaccgcaggccatcttgacgggatggatttgcggcgcgtcccggtgggcttt
cgcaccatccgcttcgatgcggaaaagggcttcttcctcaacgacaagcccgtcaaactt
aagggcgtctgcctgcatcaggatcatgccggggtgggcgttgccatccccgatgccctg
ctggcgtggcggctggcgcggctcaaggacatgggttgcaacgcgatccgctgctcgcac
aatgcgcagtccgaagcgttctatgcgctgtgcgatcgcatcggctttctcgtcatggac
gagaaccgcgtgttcaatcccgcgccagagaacatggcccagctcgaatggctggtgcgc
gcacaccgcaaccatccctcgatcgtgctgtggtcggtgttcaacgaggagccgatgcag
ggcaccacgcagggcgtcgaaatggtgcggcggatgcgcgccgccgtccgggcactggac
gacagcaggccggtaaccgcggcgatgaacggggcgttccacgatcccgtaaacgtcagc
caggtcgtcgacgtggtcggtttcaactactaccccggcgacttcgaccgtttccatgcc
gagcatccggacctgccgatcaccagttcggaagataccagcgccttcatgacacgcggc
gcctatgccagcgatccggcggggcatgtcatcacctcgatggacaaggaagcggcggct
tggggggcgacgcaccgcgatgcctggcgcgagattgccaggcgccccttcgtcgcgggc
ggcttcgtctggaccggattcgattatcacggagagccaacgccttacgactggccgacg
atttccagctacttcggcatcgtcgacctctgcggtttcgcaaagacggcatacgacatc
cgccgtgcgcagtggatcgatgaccggccggttgtcggcatcgccccgcactggacctgg
ccggggcgcgaggggcaggaaatcgaacttctggtcacctccaacgcgggccgggtccgc
ctgcggctcaacggaagggtcgttgccgaacaggactgcgatcccatcatgggcgccacg
gtcaggacgatctacgaaccgggagtgatcgaagcggaagccttgcgcggcggggaagtg
gtcgcgcgggcgatccatcgcaccgctggaaagccggttgcgttgcgcctgacgccgacg
cggaaatcgctgcggggggacggcgaggatgtggccgccttcacggtcgattgcgtcgat
gcccgggggcttcatgtgccgactgcggacgcccgtgtgcggttaggtgtcgttcggggc
acggtgctggggctcggcaacggggaccccaacagccacgagagcgagaagggcaacgag
cggtccttgttcaacggtctggcgcaggtgatcgtccgcgccgatgccggcgaagggtca
ctggcggtcgaggcaagtgcgccgggcctgcgctccgcgcgcgccagcgtgccggtccgc
caggtatccccaccgcccgcgctggcggcagccctgccgcgcattgtcgttgcagactgg
cgatgttcgcccgcctatgccgagcgccccgatcccgcgttgcggccggcggacggcgac
aacaatctttgggcattcgtccgcacgccgtgggtggcggcggatgatacgcaaccgggc
tggaggatactgaggggggtgattccggcacggcgcgcgctggcgacgcgaggagggcag
ctccagttcgatcgcgtcgccggcgtcgcggaactctggatcgacggggccttggcggtg
cgcaagggcacgcccgatccggcgccgatgaccgtggcgctcaaacccggcgcgcgcgag
atcgctctgcttgtccgctccggccccggcgtgccatcgggcatcgccggggccgtgcgg
gtcacgaccaactag

DBGET integrated database retrieval system