KEGG   Novosphingobium aromaticivorans: Saro_2441Help
Entry
Saro_2441         CDS       T00322                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Saro_2441
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Saro_2441
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_2441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2626298..2627761)
Genome map
AA seq 487 aa AA seqDB search
MTDERRILVLDEGTTSTRAILYSARGEVLGCAQEELTQYYPAPGLVEHDAAEIWERTLRC
ARAMVAQAGGAGRIAGIGVTNQRETVVAWDRSTGKPLTRAIVWQDRRTEERCRELRDAGH
EAAIQQATGLLLDPYFSASKMEWILRNVPEARALGSRLAFGTVESWLVWNLTGGLHVSDV
TNASRTSLFPLEGASWDEGLCDLFGVPLSALPEVVPSAGAFGTTRADLLGGAIPVTGLAG
DQQAATIGQGCFRAGEAKATLGTGAFILANMGTRPPRSAHRLLGTVLCEVDGVRTFALEG
SVFAAGSVVKWLRDSIGLLGTSAESEALARSVPDSGGVVVVPALSGLGAPYWKPDARASI
HGLSFATTRAHLVRAALEAMAHVFHDLGHAFAADGAGWQVLRLDGGMSANDWLAQDIADV
LGIRCERPVDVETTARGAAILAAIGAGLCPSLDHARTIVAPSAAFEPGMAAQERHGRLVR
WREAIGG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgagcgccgcatccttgttctcgacgaaggaacgacctcgacccgtgcgatc
ctctattccgcgcgaggcgaggtgctgggctgtgcgcaggaagaactgacgcaatactat
cccgcgcccggccttgtcgaacacgatgcggccgagatctgggagcggaccctgcgctgc
gcgcgcgccatggtggcgcaggcgggcggggccgggcgaattgccggtatcggcgtcacc
aaccagcgtgaaactgtcgtcgcctgggatcgttcgaccggcaagccgctgacccgtgcc
atcgtgtggcaggaccgccgaactgaagagcgttgccgcgagctgcgcgatgcaggtcat
gaggcggcgatccagcaggcaaccggcctgctgctcgatccctacttttcagccagcaag
atggagtggattctccgaaacgtccccgaagcgcgcgcgctgggttcgcggctggcgttc
gggacggtggaaagctggctggtctggaacctgaccggtggcctgcatgtcagcgacgtg
accaatgccagccgcacctcgctgtttccgctcgaaggcgcgagctgggacgaaggactg
tgcgatctgttcggcgtgcccctttcggccttgcccgaagtggtgccgagcgcaggcgca
ttcggcacgacgcgggcagacctgctgggcggagcgattcccgtcaccgggcttgccggc
gatcagcaggccgcgacaatcgggcagggctgtttccgtgcgggcgaggccaaggcgacg
ctcggcaccggggccttcatccttgccaacatgggcacccgaccgccgcgttcggcgcat
cgcctgcttggcacggtactgtgcgaggtggacggcgtgcgcactttcgcgctggaaggt
tcggtctttgccgcgggcagcgtggtcaagtggctgcgcgacagcattggcctgctgggc
acgtcagcggagagcgaggcgctggcaaggtccgtgccggacagcggcggcgtggtcgtc
gttccggcgttgtcggggctgggcgcgccctactggaaacccgatgcgcgcgcgagcatc
cacggcctgtcctttgcgacgacgcgggcgcatctcgtgcgtgcggcgctcgaggcgatg
gcgcacgtgttccatgacctcggtcatgcctttgccgcagatggggcagggtggcaggtg
ctgcgcctggacggcggtatgagcgccaacgactggctggcacaggacatcgccgacgtg
ctcggcatccgctgcgagcggccggtcgacgtggagacgaccgcacgcggggccgcgatc
ctggcggcgatcggtgctgggctatgcccttcgctcgaccatgcgcgaaccatcgtcgca
ccttccgccgcgttcgagccagggatggcggcgcaagaacgtcacgggcgtttggtccgg
tggcgcgaggctatcgggggatag

DBGET integrated database retrieval system