KEGG   Novosphingobium aromaticivorans: Saro_2481Help
Entry
Saro_2481         CDS       T00322                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2682188..2683312
Genome map
AA seq 374 aa AA seqDB search
MLQWLGLKPEETGDDPTDGPEAHQREITPREIWLPAKRRLLGNVADFLIDHDLEVMPWTL
EVAYDFVTGANPRIAQLILERSDSGQAVTLQWLEAIYRESEGDGTTDALAVLMARLEESL
EHFSSTTTSARTATSEYGAALQQHVDDLEQVSKAGVVITELAALARAMMHRTREIETDLN
ESECRARALQKSLDEARRNAEEDHLTGLPNRRAFEALFEREYQEARKAGEPLCVAFCDID
HFKRINDAHGHAAGDRVLKLVAETLNRISDARCHVARHGGEEFAVLFRSLTPDDAWERLD
RARQEIADRRLVNRATDLPFGRVTFSGGIADVFAYDSRTNALRAADDALYAAKQSGRNQI
HLAGKAPPPIQDAA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgctacaatggctgggactcaaacccgaagagaccggtgacgatcccaccgacggcccg
gaagcgcaccagcgggaaattacgccgcgcgagatctggctaccggcaaagcggcggttg
ctcgggaacgtcgcggacttcctgatcgaccacgatcttgaagtcatgccgtggaccctc
gaagtcgcctacgatttcgtgaccggtgccaatccgcgcatcgcccagctcattctcgaa
cgctccgattccggacaggcggtcacgctgcaatggctcgaggcgatctaccgcgagtcc
gagggcgatggcaccaccgatgccctggccgtcctcatggcgcgcctggaggagagcctg
gaacacttctccagcaccacgaccagcgcgcgaacggcgaccagcgaatacggggcggcg
ctgcaacagcacgtcgatgatctcgaacaggtaagcaaggctggcgtcgtcataaccgag
ctggccgctctcgcccgcgcgatgatgcaccgcacgcgcgaaatcgaaaccgacctcaac
gagtccgaatgccgtgccagagccttgcagaagagcctcgacgaggcgcgccgcaacgcc
gaggaagaccatctcaccggtctccccaaccgacgggcgttcgaagccctcttcgaacgg
gaatatcaggaagcacgcaaggccggcgagccgctgtgcgtggcattctgcgacatcgac
catttcaagcgcatcaatgacgcgcacggccatgccgccggtgaccgcgtgctgaagctc
gtggcagagacgctcaatcgcatttccgatgcacgctgccacgtcgcgcgtcacggcggc
gaggaattcgccgtcctcttccggtcgctgaccccggacgatgcctgggaacgccttgac
cgggcgcgacaggagatcgccgaccgccgtctcgtaaaccgtgccaccgacctcccgttc
ggccgcgtcacgttctctggcggcattgccgatgtctttgcctatgatagccgcaccaat
gccctgcgcgctgcggacgacgcgctttatgcggccaagcaatcgggcaggaaccagata
caccttgcaggcaaggcgccgcctcccatccaggatgcggcctga

DBGET integrated database retrieval system