KEGG   Novosphingobium aromaticivorans: Saro_2481Help
Entry
Saro_2481         CDS       T00322                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
nar  Novosphingobium aromaticivorans
Brite
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Saro_2481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2682188..2683312
Genome map
AA seq 374 aa AA seqDB search
MLQWLGLKPEETGDDPTDGPEAHQREITPREIWLPAKRRLLGNVADFLIDHDLEVMPWTL
EVAYDFVTGANPRIAQLILERSDSGQAVTLQWLEAIYRESEGDGTTDALAVLMARLEESL
EHFSSTTTSARTATSEYGAALQQHVDDLEQVSKAGVVITELAALARAMMHRTREIETDLN
ESECRARALQKSLDEARRNAEEDHLTGLPNRRAFEALFEREYQEARKAGEPLCVAFCDID
HFKRINDAHGHAAGDRVLKLVAETLNRISDARCHVARHGGEEFAVLFRSLTPDDAWERLD
RARQEIADRRLVNRATDLPFGRVTFSGGIADVFAYDSRTNALRAADDALYAAKQSGRNQI
HLAGKAPPPIQDAA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgctacaatggctgggactcaaacccgaagagaccggtgacgatcccaccgacggcccg
gaagcgcaccagcgggaaattacgccgcgcgagatctggctaccggcaaagcggcggttg
ctcgggaacgtcgcggacttcctgatcgaccacgatcttgaagtcatgccgtggaccctc
gaagtcgcctacgatttcgtgaccggtgccaatccgcgcatcgcccagctcattctcgaa
cgctccgattccggacaggcggtcacgctgcaatggctcgaggcgatctaccgcgagtcc
gagggcgatggcaccaccgatgccctggccgtcctcatggcgcgcctggaggagagcctg
gaacacttctccagcaccacgaccagcgcgcgaacggcgaccagcgaatacggggcggcg
ctgcaacagcacgtcgatgatctcgaacaggtaagcaaggctggcgtcgtcataaccgag
ctggccgctctcgcccgcgcgatgatgcaccgcacgcgcgaaatcgaaaccgacctcaac
gagtccgaatgccgtgccagagccttgcagaagagcctcgacgaggcgcgccgcaacgcc
gaggaagaccatctcaccggtctccccaaccgacgggcgttcgaagccctcttcgaacgg
gaatatcaggaagcacgcaaggccggcgagccgctgtgcgtggcattctgcgacatcgac
catttcaagcgcatcaatgacgcgcacggccatgccgccggtgaccgcgtgctgaagctc
gtggcagagacgctcaatcgcatttccgatgcacgctgccacgtcgcgcgtcacggcggc
gaggaattcgccgtcctcttccggtcgctgaccccggacgatgcctgggaacgccttgac
cgggcgcgacaggagatcgccgaccgccgtctcgtaaaccgtgccaccgacctcccgttc
ggccgcgtcacgttctctggcggcattgccgatgtctttgcctatgatagccgcaccaat
gccctgcgcgctgcggacgacgcgctttatgcggccaagcaatcgggcaggaaccagata
caccttgcaggcaaggcgccgcctcccatccaggatgcggcctga

DBGET integrated database retrieval system