KEGG   Novosphingobium aromaticivorans: Saro_2787Help
Entry
Saro_2787         CDS       T00322                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Saro_2787
Enzymes [BR:nar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Saro_2787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3007453..3008133
Genome map
AA seq 226 aa AA seqDB search
MKLLPLIVIRPEPGNAATIAAARERGLHAIGYPLFRIEPTRWSVAEGRFEAILAGSANIF
RHGGPQLDALKHLPVIAVGEATASAARAAGFTVVRTGEGGLQPVVETLAPGTYLRLAGED
RVTLAPPPGVRIETAVVYAARPVPLPDELVAVLARPAVVLLHSGAAAKHFRQQCERTGIT
RESLYLACLAPRIAALAGDGWGDLRIADSRTDSDLLELGRRMCQTM
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcctgccgctcatcgtcatccgtcccgagcccggcaatgccgcaaccattgcc
gccgcgcgcgaacggggccttcatgcgatcggctacccgctcttccggatcgagccgaca
cggtggagcgttgccgaagggcggttcgaggcgatcctggcgggaagcgccaacatcttc
cggcacggcgggccgcaactcgacgcactgaagcatctccccgtcatcgcggtgggcgaa
gcgacggcctcggccgcccgcgcggcaggcttcaccgttgtccgaaccggcgaaggcggc
ctgcaaccggtggtggagacgcttgcccccggcacctatctgcggctcgcgggcgaagac
agggtcacgctcgccccgccgccgggcgtgcgaatcgagacggcggtcgtctatgcggcc
cgccccgtcccgcttccggacgagctggtggcggtactggcgcgtccagcggtcgtcctg
ctgcattccggcgcagccgcgaagcatttccgtcagcagtgtgaacgcactggaattact
cgggaaagcctctatctagcgtgcctcgccccgcgcatcgccgcacttgcgggcgatggt
tggggcgatctgcgcatcgctgactcaagaacggactccgatctgctggaactaggccgg
cgaatgtgccagaccatgtga

DBGET integrated database retrieval system