KEGG   Novosphingobium aromaticivorans: Saro_3061Help
Entry
Saro_3061         CDS       T00322                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00240  Pyrimidine metabolism
nar00250  Alanine, aspartate and glutamate metabolism
nar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Saro_3061
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Saro_3061
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Saro_3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Latrotoxin_C
Motif
Other DBs
NCBI-ProteinID: ABD27496
UniProt: Q2G3S7
Position
3279684..3280709
Genome map
AA seq 341 aa AA seqDB search
MQSQNTPAAGRYPAGGLAFPHRDLTGIGQLARHEILYLLDEAEQWVELNRQSQKTTDLLN
GLTIINAFFENSTRTLLSFEIAGKRLGADVVNMHAATSSVKKGETLIDTAMTLNAMRADA
IVIRHASSGAVRLIAEKVDCPVLNAGDGQHEHPTQALLDALTMRHAMKLPAGSDLNGLKV
TICGDILHSRVARSNILSLTALGAEVRVCAPPALMPAEIEAMGVTPFHDFDAALKGANIV
MMLRLQQERMSGQFIPSPREYRHLYGLTPERLARAEADAFVMHPGPMNRGIEIDSTVADH
PTRSLITRQVEMGVAIRMACLEVLTRRARRTPGWEAEGASA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagccagaacaccccagcagcgggccgctatccagcgggcggcctcgccttcccg
caccgtgacctgaccggcatcggccagcttgcgcgccacgagattctctacctcctcgac
gaggcggaacagtgggtggaactgaaccggcagagccagaagacgaccgatcttctcaac
ggcctgacgattatcaacgccttcttcgagaactcgacccgcacgctgctgagcttcgag
atcgcgggcaaaaggctgggcgcggacgtggtcaacatgcacgccgccaccagcagcgtg
aagaagggcgaaacgctgatcgacacggcgatgacgctcaatgccatgcgcgcggacgca
atcgtcatccgtcacgccagttcgggcgcggtgcgcctcatcgcggaaaaggtggactgc
ccggtgctgaatgccggcgacggacagcacgagcacccgacgcaggccctgctcgatgcg
ctgacgatgcgccatgcgatgaagctgcccgcaggatcggacctcaatggtctgaaagtg
acgatctgcggggacatcctgcacagccgcgtggcgcgatccaacattctgagcctgacc
gccctgggcgcggaagtccgcgtatgcgcgcctcccgcgctgatgccggccgagatcgag
gcaatgggcgtgacgcccttccacgacttcgacgcggcgctcaaaggggccaacatcgtg
atgatgctgcgccttcagcaggagcgcatgtcgggacagttcatcccctccccgcgcgag
tatcgccacctctacgggttgacgcccgaacggctggccagggcggaggccgacgctttc
gtgatgcatcccgggccgatgaaccgcggcatagagatcgattcgaccgtggcggaccat
cccacgcgcagcctgatcacgcggcaggtcgaaatgggtgttgccatccgcatggcctgc
ctcgaggtgctgacgcggcgggcacggcgcaccccgggctgggaagcggaaggagcctcg
gcatga

DBGET integrated database retrieval system