KEGG   Novosphingobium aromaticivorans: Saro_3092Help
Entry
Saro_3092         CDS       T00322                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Saro_3092
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Saro_3092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3312771..3313274)
Genome map
AA seq 167 aa AA seqDB search
MNRYLIALGSNQRHPRHGLPSMILRAAVDELRGEGVLVEAVSPTLRSRPLGPSLREYANG
AAVISTHLDPPELLELLQQVERRFGRRRQGQRWRSRTLDLDVVLWSGGFWADEALVIPHR
EFRKRDFVLAPAAKIAPDWRDPLTGLTIRHLAARLARPLTRRPPHPR
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgatatctcatcgcgctgggatcaaatcagcgccacccccgtcatggcctgccg
tccatgatcctgcgggcagcggtggacgaactgcgcggtgaaggggtccttgtcgaggcg
gtcagcccgacgctgcgcagccgccctctcgggccgtcgctgcgcgagtatgcgaacggt
gcggccgtgatttccacgcatctcgacccgcccgaacttctcgaactcctgcaacaggtc
gaacgtcgcttcggccggcgacggcaaggccagcgctggcgctcgcgcacgctcgacctt
gacgtggtgctgtggtcgggcggcttttgggcggacgaggcgctggtcattccccaccgc
gaattccgcaagcgcgatttcgtcctcgcgccggccgcgaaaattgcccccgactggcgc
gatcccctgacgggtctgaccatccgccatctcgccgcccgccttgcccgccccttgacc
cgccgccccccgcaccctaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system