KEGG   Novosphingobium aromaticivorans: Saro_3170Help
Entry
Saro_3170         CDS       T00322                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00020  Citrate cycle (TCA cycle)
nar00640  Propanoate metabolism
nar00660  C5-Branched dibasic acid metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01200  Carbon metabolism
Module
nar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saro_3170
   00640 Propanoate metabolism
    Saro_3170
   00660 C5-Branched dibasic acid metabolism
    Saro_3170
Enzymes [BR:nar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Saro_3170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABD27605
UniProt: Q2G3G8
Position
complement(3384930..3386129)
Genome map
AA seq 399 aa AA seqDB search
MNVHEYQAKELLAKYGVGIPAGIAALTVEEAVAAAKQLPGPLYVVKAQIHAGGRGKGKFK
ELPADAKGGVRLAKSIEEVEAFAKEMLGNTLVTVQTGEAGKQVNRLYVTDGVDIDKEYYL
SMVVDRATGRVAIIVSTEGGMDIEEVAHSTPEKIATIVIDPAEGFMPHHGRAVGFALKLS
GDLLKQAAKIAEQLYTAFVALDCSMLEINPLVQTKDGNLLVLDTKMSFDSNALYRHPDVV
ALRDETEEDPAEIEASKYDLAYIKLDGNIGCMVNGAGLAMATMDIIKLNGEFPANFLDVG
GGANKEKVTAAFKIILKDPAVKGILVNIFGGIMKCDIIAEGIVAAAKEVNLSVPLVVRLE
GTNVQQGKDILANSGLPIVPANDLGDAAKKIVAEVRAVA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccatgaataccaggccaaggaactgctcgcgaagtatggtgtgggcatcccg
gcaggcatcgccgcgctgacggtcgaggaagccgtcgccgctgccaagcagcttcccgga
ccgctttacgtcgtcaaggcgcagatccacgccggcggccgcggcaagggcaagttcaag
gaactccccgccgacgccaagggcggcgtgcgcctcgccaagagcatcgaggaagtcgag
gctttcgccaaggaaatgctcggcaacaccctcgtcaccgtgcagaccggtgaagccggc
aagcaggtcaaccgcctctacgtgaccgacggcgtcgacatcgacaaggaatactacctc
tcgatggtcgtcgatcgcgccaccggccgcgtcgcgatcatcgtgtcgaccgaaggcggc
atggacatcgaggaagtcgcccactcgaccccggaaaagatcgccaccatcgtgatcgat
cccgccgaaggcttcatgccgcaccacggccgcgccgtcggtttcgcgctcaagctttcg
ggtgacctgctcaagcaggccgccaagatcgccgagcagctctacaccgccttcgtcgcg
ctcgactgctcgatgctcgaaatcaacccgctggtgcagaccaaggatggcaacctcctc
gtgctcgacaccaagatgagcttcgattcgaacgcgctctatcgtcaccccgatgtcgtc
gccctgcgcgacgaaaccgaggaagacccggccgagatcgaggccagcaagtacgacctc
gcctacatcaagctcgacggcaacatcggctgcatggtcaacggcgcgggccttgccatg
gcgacgatggacatcatcaagctgaacggcgaattcccggcgaacttcctcgacgtgggc
ggcggcgccaacaaggaaaaggtcaccgcagccttcaagatcatcctcaaggacccggcc
gtgaagggcattctcgtcaacatcttcggcgggatcatgaagtgcgacatcatcgccgag
ggcatcgttgccgcggcgaaggaagtgaacctctcggttccgctggtcgttcgcctcgaa
ggcaccaacgtccagcagggcaaggacatcctcgccaactcgggcctgccgatcgttccc
gccaacgacctcggcgatgccgccaagaagatcgttgccgaagtgcgcgcggtcgcctga

DBGET integrated database retrieval system