KEGG   Novosphingobium aromaticivorans: Saro_3241Help
Entry
Saro_3241         CDS       T00322                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00250  Alanine, aspartate and glutamate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Saro_3241
Enzymes [BR:nar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Saro_3241
Peptidases [BR:nar01002]
 Cysteine Peptidases
  Family C44
   Saro_3241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6
Motif
Other DBs
NCBI-ProteinID: ABD27676
UniProt: Q2G397
Position
complement(3463030..3464979)
Genome map
AA seq 649 aa AA seqDB search
MTKTVLILTAAIDLDGGDWFSPCWERVTRSMALGKAGDIIHGCVPGAALAIREEKPIAAG
RSAQNRRGSFREQEDGSYVLLAGRIFNRTDLLRRFDLKQGMDDADLYAAVSARMGEAAYR
AIVGDYAALQWFPQRRSLRLARSGTSNMPLHVWRDGSRIVISSLPGPILASGVPARINDD
RVADELLLFSPDGRTSFYAGMHRVPGGGEEVHDPSGFKARRLWSVKDAPEIRLRRDEDYV
EALDVLFDEAVSATMDGSSAPGILLSGGFDSQTVASYAVKRLPAGRRLQAFTSVPMQGWT
PPPRPGIFGDESAHVRALCAMYPQIEPHFIEAADFRYGERGHRQFLVGGWPVFNEMNAHW
SHASLEQAADLGCDLMLTGDLGNSGFSYDGLTGYPTWLREGQWFRLLREIGKSDDPRPFW
RKLISLAVMPHVPVRWKRKMDRHRPWRPSAFATWCGMREDFARESGVLDRAEAGGHDIDF
YDIPSARTWRANVVDSLNDGAPEIYLGYQLLYGVPMRDPTAYLPLLEFCAGIPDEQYLRD
GQTRWLARRLMQGRVPEMVRLENRIGAQSSDWPQRFARDREDLIAEMERMKADERLAKIF
DFERLAANLREWDGSDRPESRSNFKINAAVGRAMVSARFVSHVEGRNVG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaagaccgttctcatcctgactgccgcaatcgacctcgatggcggggactggttc
tcgccctgctgggagcgcgtgacccggtcgatggccctcggcaaggccggcgacatcatt
catgggtgcgttccgggcgccgcccttgccatccgcgaggagaagccgattgccgctggc
cgttcggcccagaaccggcgcggcagctttcgcgagcaggaggacgggtcctacgtcctg
cttgcggggcgcatcttcaatcgcaccgacctcctgcggcgcttcgacctgaagcaggga
atggacgatgccgacctttatgcggcggtctcggcgcgcatgggcgaggcggcctatcgc
gcaatcgttggcgactacgcggcgttgcaatggttcccgcaacgccgctcgctgcggctg
gcgcgttcgggcaccagcaacatgccgctgcacgtgtggcgcgacggttcccggatcgtg
atctcctcgctgcccggcccgatcctggcgagcggcgtaccggcaaggatcaacgacgat
cgcgttgccgacgagcttctgctgttttccccggacgggcgaaccagtttctacgcgggc
atgcaccgcgttcccggcggcggcgaggaagtgcacgatccctcgggcttcaaggcgcgc
cgcctctggtcggtgaaggatgcgcctgaaatcaggctacggcgcgacgaggactacgtc
gaagcactggatgtgctgttcgacgaagcggtttcggcaacaatggacggctcgagcgcg
cccggcatcctgctgtccggcggtttcgattcgcagaccgtcgccagctatgcggtgaag
cgcctgccggcgggacggcgattgcaagccttcacctcggttccgatgcaaggttggacc
ccgcctccccggcccggaatattcggcgacgaatcggcgcacgtccgcgcgctctgtgct
atgtacccgcagatcgagccgcacttcatcgaagcggcggacttccgctatggcgagcgg
ggtcaccggcagttcctcgtcggaggatggcccgtctttaacgagatgaacgcccattgg
agccatgcttcgctcgagcaggcggccgatctgggctgcgacctcatgctgaccggagac
ctcggcaattccggcttcagctatgacggtctgaccggttacccgacctggctgcgcgag
gggcagtggtttcgactgttgcgggaaatcggcaagtcggacgacccgcggccattctgg
cgcaagctgatttccctcgccgtgatgccccacgtacccgtgcgctggaagcgcaagatg
gaccggcatcgcccgtggagaccttcggccttcgcgacctggtgcggcatgcgcgaggac
tttgcccgtgaaagcggcgtgctggatcgcgcggaagccggggggcacgatattgatttc
tacgacatcccatcggccaggacgtggcgggcgaacgttgtcgattcgctgaacgacggt
gcgccggaaatctacctcggctaccagcttctctacggcgtgccgatgcgcgacccgacg
gcctacctgccgttgctcgagttttgcgcaggcatcccggacgagcaatacctgcgcgat
gggcagacgcgctggctggcgcggcggctgatgcagggccgggtcccggagatggtccgg
ctggaaaatcgcatcggcgcccagagcagcgactggccacagcggtttgcgcgggaccgt
gaggatcttatcgccgagatggagcggatgaaggcggacgagcgcctggcgaagatcttc
gatttcgagcgtcttgccgccaacctgcgcgaatgggacggctcggacaggcccgaaagc
cgatcgaacttcaagatcaacgccgcagtcggacgggccatggtttcggcgcgcttcgtc
agccatgtggaaggccgcaatgtcggctga

DBGET integrated database retrieval system