KEGG   Novosphingobium aromaticivorans: Saro_3463Help
Entry
Saro_3463         CDS       T00322                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00071  Fatty acid degradation
nar00350  Tyrosine metabolism
nar00625  Chloroalkane and chloroalkene degradation
nar00626  Naphthalene degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_3463
  Lipid metabolism
   00071 Fatty acid degradation
    Saro_3463
  Amino acid metabolism
   00350 Tyrosine metabolism
    Saro_3463
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saro_3463
   00626 Naphthalene degradation
    Saro_3463
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Saro_3463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABP64323
JGI: Saro_3463
UniProt: A4XEG2
Position
pNL2:complement(64456..65460)
Genome map
AA seq 334 aa AA seqDB search
MIPHGEHSMLAMQLDGPGKRLHPVVRPLPLPGRGEVRVKVHACGVCRTDLHVADGDIHGL
LPIVPGHEVIGVVDALGPGVTDVEPGARVGVPWLGHACGTCPYCDSGRENLCDAPLFTGF
TRDGGYATHVIADARFCFPIPEGFDDLHAAPLLCAGLIGYRALRLAGDAPVLGFYGFGAA
AHILAQVALWQGRTVYAFTRDGDAKAQAFARDIGCQWAGPSGAAPPQALDAAIIFASAGE
LVPTALRAVRKGGRVVCAGIHMSDIPAFPYADLWEERQILSVANLTRRDGVEFLPLAARA
GVRTHVEAMPLMKANEALDRLRRGDVSGALVLVP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatcccccatggcgaacactcgatgctggcaatgcagctcgatggtcccggcaagcgg
ctgcaccccgtcgtgcgccctctgccccttccggggcgcggcgaagtgcgggtcaaggtg
cacgcctgcggtgtctgccgcacggacctgcacgttgccgacggcgacatccacggtctg
ctacccatcgtgcccgggcacgaagtgatcggcgttgtcgacgcactggggccgggggtg
acggatgtcgagcccggtgcgcgggtcggcgtcccctggctcggccatgcctgtggcacc
tgcccatattgcgacagcgggcgggaaaacctctgcgacgcgccgctgttcaccggcttc
acccgcgatggcggctacgctacccacgtgatcgccgacgcgcgcttctgctttcccatt
ccagagggtttcgacgatctccacgcggcgccgctcctgtgcgcgggccttatcggctat
cgcgcgcttcggcttgccggcgatgcccctgtcctcggcttctacggcttcggagcggcg
gcgcacatcctcgcgcaagtggccctgtggcaggggcgcacggtttacgcgttcactcgc
gatggcgacgcgaaggcccaggcctttgctcgtgacatcggttgccaatgggccggaccc
tctggcgccgcgccgccgcaagcgctcgacgcagcgatcatcttcgcctctgcgggagaa
ttggtgcccaccgccctgcgtgccgtgcgcaagggcgggcgcgtggtctgtgccgggatc
cacatgagcgacatcccggccttcccctacgccgatctctgggaggaacggcagatcctc
tcggtcgccaatcttacccggcgcgatggcgtcgaattcctgccccttgcagcgcgggca
ggcgtgcgcacacatgtcgaggccatgccgctaatgaaggcgaacgaggccctcgaccgc
ctgcgccgtggcgacgtcagcggcgcgctggtgctcgtgccctga

DBGET integrated database retrieval system