KEGG   Novosphingobium aromaticivorans: Saro_3581Help
Entry
Saro_3581         CDS       T00322                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Saro_3581
Enzymes [BR:nar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Saro_3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pNL2:199847..201334
Genome map
AA seq 495 aa AA seqDB search
MALKIKRIAIDTHPENTAFLLRRRNGYSPEQFVALRKIEITGGDASILATLALIDDESLL
EPHMIGLGEQAFRRLGLPEGAEVTFRQAPVPHSLEHVRRKIDGDELEETEIAEIIRDIAG
YRYSPMEIGAFLVACAGFMSTHETLALTRAMAGVGRQMHWPSEIVVDKHCIGGIPGNRTS
MIIVPIIAAHGLTMPKTSSRAITSPSGTADTMEVLASVDLPEDRLVSIVAKEHAVLAWGG
RVNLSPADDVLITVERPLRIDTFDQMVASILSKKLAAGSTHLLIDIPVGPTAKVRTTREA
IRLRKLFEYVGHRLGLVLDIVVTDGSQPVGRGVGPVLEARDVMAVLRNEDDAPRDLRERA
VMLAGRVLEFDPALAGGKGYARAMELLGSGAALAAMERLIDAQGRCREVILPGSHVHDIC
APAGGTVMSIDCHLIARIARLAGAPMDKGAGIDLLHKVGDRVRADEVLYRIHAHSPTGLE
YARELAVASSGYVVG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccttgaaaatcaagcgcatcgcgatcgacactcacccggagaacaccgcgttcctc
ctgcgcaggaggaacggctattcgcccgaacagttcgtcgcgctgcgcaagatcgagatc
accggcggcgatgcgtcgatcctcgccaccctggcgctgatcgatgacgagagcctgctc
gaaccgcacatgatcggccttggcgaacaggccttccgccgcctcggcctgcccgaaggc
gcggaagtaaccttccgccaggcgcccgtcccgcacagcctcgaacacgtccgtcgcaag
atcgacggcgacgaactggaagaaaccgagatcgcggagatcatccgcgacatcgccgga
taccgctattccccgatggagatcggggccttcctcgtcgcctgcgccgggttcatgtcc
acgcacgaaacgcttgccctcacccgcgcaatggccggcgtcggccgccagatgcactgg
ccgtccgaaatcgtcgtcgacaagcactgcatcggcggcatccccggcaaccgcacctcg
atgatcatcgtgccgatcatcgccgcgcacgggctgaccatgcccaagacctcgtcgcgc
gcgatcacctcgccatcgggcacggccgacacgatggaagtcctcgcctcggtggacctg
ccagaggaccggctcgtctccatcgtggcaaaggaacacgcggtgcttgcctggggcggc
cgggtgaacctgtcgcccgccgacgacgtgctgatcaccgtcgagcgtccgttgcggatc
gacaccttcgaccagatggtcgcctcgatcctgtcgaagaagctggccgccggctcgacc
caccttctcatcgacattcccgtcggccccaccgccaaggtccgcaccacgcgcgaggcg
atccgcctgcgcaagctgttcgaatacgtcggccatcgtctcggcctcgttctcgacatc
gtcgtcaccgacggctcgcagccggtgggccggggcgtgggccccgtgctcgaggcgcgc
gacgtgatggccgtcctgcgcaacgaggacgacgcaccccgggacttgcgcgaacgcgcc
gtcatgctcgcgggccgggtgctcgaattcgatcccgcgctggcgggcggcaagggctat
gcccgcgcgatggaactgctcggttccggtgccgcgctggcggcgatggagcgcctgatc
gatgcgcagggccggtgccgcgaagtgatccttcccggcagccacgtccacgatatctgc
gcgccagccggcgggacggtcatgtccatcgattgccacctgatcgcgcgcatcgcccgc
cttgccggcgcgccgatggacaagggcgcgggaatcgacctgctgcacaaggtgggcgac
cgggtgcgcgctgacgaagtgctctatcgcatccacgcccactctccgaccggcctcgaa
tatgcgcgcgaactggccgtggcgagttccggttacgtggtcggatga

DBGET integrated database retrieval system