KEGG   Novosphingobium aromaticivorans: Saro_3755Help
Entry
Saro_3755         CDS       T00322                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Saro_3755
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Saro_3755
   00650 Butanoate metabolism
    Saro_3755
  Lipid metabolism
   00071 Fatty acid degradation
    Saro_3755
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_3755
   00310 Lysine degradation
    Saro_3755
   00360 Phenylalanine metabolism
    Saro_3755
   00380 Tryptophan metabolism
    Saro_3755
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Saro_3755
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Saro_3755
   00281 Geraniol degradation
    Saro_3755
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_3755
   00627 Aminobenzoate degradation
    Saro_3755
   00930 Caprolactam degradation
    Saro_3755
Enzymes [BR:nar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Saro_3755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pNL2:393725..394480
Genome map
AA seq 251 aa AA seqDB search
MPITLTVKDRIAEIVFDVPPVNAFDSETWMSLPAIVKKAASDPEANVVLIRAAEDSRGFC
GGVDIKEMQAHPERITVLNRGNYLTFKAIHEAEIPVVVAVHKFVIGGGIGICGASDVIIA
SDDAFFSLPEVDRGAMGGASHMSRMLPLHKVRAAFFTGGNIPAQEAYRLGAVEKVVPRTD
LVAEAQAFCSVIASKSRKALVIAKEALNGLEARDVDRGYRWEQGFTLEMYMHEDSQKARD
AFVETGKAAQF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcacgctcaccgtaaaggaccgcatcgccgaaatcgtgttcgacgttccgccc
gtcaatgcgttcgacagcgagacctggatgtcgctgcccgccatcgtgaagaaggcggcg
tccgatccggaagcgaacgtcgtcctgatccgtgccgccgaggactcgcgcggcttctgc
ggcggcgtcgacatcaaggagatgcaggcccaccccgaacgcatcaccgtgctcaatcgc
ggcaactacctgaccttcaaggcgatccacgaagcggagatcccggtcgtcgttgccgtg
cacaagttcgtgatcggcgggggcatcggcatttgcggcgcaagtgatgtcatcatcgcg
tccgacgacgcgttcttctcgttgccggaagtcgaccgcggggcaatgggcggggctagc
catatgtcgcgcatgttgccgctccacaaggtgcgcgcggcgttctttaccggcggcaac
attcccgcgcaggaagcctatcgccttggcgcggtcgaaaaggtcgtgccccgcaccgat
cttgtcgccgaagcccaggccttttgcagcgtcatcgcttccaagagccggaaggccctc
gtgatcgccaaggaagcgctcaacggcctcgaggcacgcgatgtcgatcgcggttatcgc
tgggaacagggcttcacgctcgaaatgtacatgcacgaggacagccagaaggcgcgtgac
gccttcgtcgagaccggcaaggcggcccaattctaa

DBGET integrated database retrieval system