KEGG   Novosphingobium aromaticivorans: Saro_3769Help
Entry
Saro_3769         CDS       T00322                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Saro_3769
Enzymes [BR:nar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Saro_3769
Transfer RNA biogenesis [BR:nar03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Saro_3769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pNL2:406935..407681
Genome map
AA seq 248 aa AA seqDB search
MNDAELAAHLAEYAGKLLLTVRESGMLSLKQLGKAGDATANQFLVHALREQRPDDGLLSE
EEKDNLDRLQFSRTWIVDPVDGTREYGEARTDWAVHVGLAIDGVATVGAVALPGAGVVLR
TDRPQVVPPAPETLRMVVSRTRPAHEAVTIAEKIGAELVPMGSAGAKAMAVILGEADIYL
HSGGQFEWDSCAPVAVALAHGLHCSRIDGSPLVYNQAETYMPDLLICRPEHARMVLDEVA
AVHAGTPA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcagaactcgccgcccatctcgccgaatatgcaggcaagctgctgctgacc
gtgcgcgaaagcgggatgctcagcctcaagcagctcggcaaggcgggcgatgcgacagcg
aaccagttcctggtccatgccctgcgcgaacagcggccggatgacggactgctttccgag
gaggagaaggacaacctcgaccgcctgcaattctcgcgcacgtggatcgtcgacccggtg
gacgggacccgcgaatatggcgaggcgcggaccgactgggcggtgcacgtggggcttgcc
atcgatggcgtggcgacggtcggcgccgttgcgttgccgggcgcgggtgtggtgctgcgc
acggacaggccacaggtcgttcctcccgcacccgagacgctgcgcatggtcgtaagccgt
acccggcccgcgcacgaggccgtgaccatcgccgaaaagatcggcgctgaactggtgccc
atgggtagcgcgggtgcgaaggccatggcggtgatccttggcgaggcggatatctacctg
cactcgggcggtcagttcgaatgggattcctgtgcgccggtcgccgtcgcactggctcac
gggctgcactgttcgcggatcgatggcagtccgctggtttacaaccaggccgaaacatac
atgcccgacctgctgatctgccgcccggaacacgctcgcatggtgctggacgaagtcgcc
gcggttcatgccgggacgcctgcctga

DBGET integrated database retrieval system