KEGG   Novosphingobium aromaticivorans: Saro_3817Help
Entry
Saro_3817         CDS       T00322                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
nar  Novosphingobium aromaticivorans
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:nar00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:nar02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pNL2:474223..474606
Genome map
AA seq 127 aa AA seqDB search
MSVRAFMLTAGLSAVALASGALATPTADVARGKALFARCAGCHAVVPGARSIGPNLAGVE
GRKAASAGSYAYSPALARLKITWDRGNLDKFLAGPQKMAPGSKMAFAGLADPGQRADVIA
YLATLQD
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgcgtgcgttcatgctgactgccgggctttcggcagtggcgcttgcctctggc
gcgctagccaccccgacggccgacgtcgcgcgcggcaaggccctgttcgcacgttgtgcc
ggttgccatgccgtggtgcccggcgcgcgatcgatcgggcccaacctggcgggggtagag
gggaggaaggcggcatctgccggttcctatgcctattcgcccgccctcgcccggctgaaa
atcacctgggatcgcggcaatctcgacaaattccttgcgggcccgcaaaagatggcaccg
ggatcgaagatggcgttcgccgggctggcggatccggggcagcgggcagatgtcatcgcc
tatctcgcaacgctgcaggactga

DBGET integrated database retrieval system