KEGG   Novosphingobium aromaticivorans: Saro_3817Help
Entry
Saro_3817         CDS       T00322                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
nar  Novosphingobium aromaticivorans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Saro_3817
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Saro_3817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pNL2:474223..474606
Genome map
AA seq 127 aa AA seqDB search
MSVRAFMLTAGLSAVALASGALATPTADVARGKALFARCAGCHAVVPGARSIGPNLAGVE
GRKAASAGSYAYSPALARLKITWDRGNLDKFLAGPQKMAPGSKMAFAGLADPGQRADVIA
YLATLQD
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgcgtgcgttcatgctgactgccgggctttcggcagtggcgcttgcctctggc
gcgctagccaccccgacggccgacgtcgcgcgcggcaaggccctgttcgcacgttgtgcc
ggttgccatgccgtggtgcccggcgcgcgatcgatcgggcccaacctggcgggggtagag
gggaggaaggcggcatctgccggttcctatgcctattcgcccgccctcgcccggctgaaa
atcacctgggatcgcggcaatctcgacaaattccttgcgggcccgcaaaagatggcaccg
ggatcgaagatggcgttcgccgggctggcggatccggggcagcgggcagatgtcatcgcc
tatctcgcaacgctgcaggactga

DBGET integrated database retrieval system