KEGG   Novosphingobium aromaticivorans: Saro_4008Help
Entry
Saro_4008         CDS       T00322                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nar  Novosphingobium aromaticivorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pNL1:complement(175749..176645)
Genome map
AA seq 298 aa AA seqDB search
MKLKSLKSFHLARPRLGQVLMPLAAIALGSGGSLVWANAGTGDAATAQHAPSEADQAVTA
LLKQRLPRTQVSRVNCQVVDGVCEVTAGSQLFYVDKTARYLLIGRVYDMQTRQDLTAVRL
LEVNPDLLVGGAAGSKQEAQEVETPRRGVSTPAASGAPRMMSLAALPEAGGIVWGANSGP
TVTVFSDFRCGYCRALSGVLENMNVRVIERPISVLGSRDLANQVFCARDRRKAVKAAYAG
APITDTRACDTSPLDANEAFARQQGLAGTPVIVRSDGAVIEGFRPREVLEQWLKGAKS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaagtccttgaagtcattccatctggcgcggccccgccttggccaggtcctg
atgccgctcgccgcgatcgcgctcggtagtggcggctcgctggtctgggcgaacgccggc
accggtgatgccgcaactgcccaacatgccccaagcgaggcggaccaggcggtgaccgcg
ctcctgaagcagcgcctgccgcgcacccaggtctcccgcgtcaattgccaggtggtcgat
ggggtctgcgaagtgaccgcaggctcgcagctgttctacgtcgacaagaccgcgcgatat
ctcctgatcgggcgggtctacgacatgcagacccgccaggacctgactgcggtccggctg
ctcgaggtcaaccccgatctcctcgtcggcggcgctgcggggagcaagcaggaagcccag
gaagtcgagaccccacgccgcggcgtcagcacgccggcggcgagcggtgccccccggatg
atgtcgctcgccgcactgcccgaggcgggcggcattgtctggggagcaaactcggggccg
accgtgaccgtgttcagcgattttcgctgcggctactgccgggcgctctcgggcgtcctc
gaaaacatgaacgtgcgggtgatcgagcggccgatctcggtgctcggcagccgcgatctt
gccaaccaggtgttctgcgcgcgcgatcgccgcaaggcggtcaaagccgcctatgccggg
gcgccgataacagacacgcgcgcctgcgacacctcgccgctcgatgccaacgaggccttc
gcgcgccagcagggccttgccggaaccccggtcatcgtccgctcggacggcgcggtgatc
gaaggcttccgcccgcgcgaagtgctcgagcagtggctgaagggcgccaagtcgtga

DBGET integrated database retrieval system