KEGG   Natrinema sp. J7-2: NJ7G_0034Help
Entry
NJ7G_0034         CDS       T02184                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_0034
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_0034
   00020 Citrate cycle (TCA cycle)
    NJ7G_0034
   00620 Pyruvate metabolism
    NJ7G_0034
Enzymes [BR:nat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NJ7G_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(36291..37946)
Genome map
AA seq 551 aa AA seqDB search
MVREFELPDVGEGVAEGELVSWLVAEGDTVTEDKPVAEVETDKALVEVPAPVDGTVRELH
VEEGDIVPVGTVIISFDVDGEDSSATEAGDDAASEGGVAHEPTEPDRAETSDPAGEPGAT
GADTESVAPPDDRVFAPPRVRRMAREEGIDLSTIQGSGPGGRITAGDVQAATGGGAAAES
AQGQSRTPESASGGAASGQTDSSDASAGAGTAAEAPTERATGASSPQQSETPAGIESADR
DTTLAAPATRRIAEEEDVDIDAVPATEERDGEAFVTPEAVREYADLQRQAQEADAEAVAS
GDPVGTTGAGFAEGERERRESFRGVRKRIADAMVESKYSAPHVTHHDEVDVTELVAVRSD
LKPRAEERGIRLTYMPFIMKAVIAALKEHPEMNAVIDEENEEIVYRDYYNIGVATATDVG
LMVPVVDDADRKGLLQLSSEMNELVQKARDRTIGPDELRGSTFTITNIGGIGGEYATPIL
NYPEAGILAVGEIKRKPRVVTDETGAESIEPRSVMTLSLSFDHRLIDGAVGAQFTNTVME
YLENPSLLLLE
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggtcagggagttcgaactaccggacgtcggcgaaggagttgcggagggcgaactggtc
tcgtggctggtcgcggaaggcgacacggtcacggaggacaaaccggttgccgaggtcgag
actgacaaggcgctcgtggaggttcccgcaccggtcgacggcaccgtccgcgagttacac
gtcgaggagggtgacatcgtcccggtcgggacggttatcatctcgttcgacgtcgatggc
gaggactcgagtgccacggaagcgggcgacgacgccgcgagcgagggcggcgtggcccac
gagcccaccgagccggaccgagcggagacgagcgaccccgccggtgaacccggcgcgact
ggggccgacaccgagtcggtcgcaccgcccgacgatcgtgtcttcgcgcccccgcgcgtt
cgccgcatggctcgcgaggagggaatcgacctctcgacgatccaggggagcggccccggc
ggacggatcactgcgggcgacgtacaggcagcaacgggcggcggagccgccgccgaatcg
gcgcagggccagtcacggacacccgagtcggcgtccggcggggcggcatccggacagact
gactcgagcgacgcgagtgcaggtgccggtaccgccgcggaagcgcccacggaacgggcg
actggggcctcgagtccccagcaatcggagacgccggcagggatcgagtcggcggaccgc
gacacaaccctcgctgcacccgcgacccgtcggatcgccgaggaggaggacgtcgacatc
gacgccgtcccggcgacggaggaacgcgacggcgaggcgttcgtcacccccgaagcggtc
cgggagtacgccgacctccagcgccaagcgcaggaagccgacgccgaggcggtcgcctcc
ggcgacccggtcggaacgacaggtgccggctttgccgagggcgagcgcgaacgccgcgag
tcgttccggggcgtccgcaaacggatcgccgacgcgatggtcgagtcgaagtatagtgcc
ccgcacgtcactcaccacgacgaggtcgacgtcaccgaactcgtcgcggtccggtcggac
ctcaaaccgcgcgccgaggagcgcgggatccggctgacctacatgccgttcatcatgaaa
gccgtcatcgcggcgctgaaagaacaccccgagatgaacgcggtcatcgacgaggaaaac
gaggagatcgtctaccgcgattactacaacatcggggtcgcgaccgcgaccgatgtcggg
ctgatggtgccggtcgtcgacgacgcggaccggaaggggctcctccaactctcctcggaa
atgaacgaactcgtccagaaagcccgtgatcgaacgatcgggcccgacgaacttcgcggg
tcgacgtttacgatcaccaacatcggcgggatcggcggcgagtacgccacgccgatcctc
aactatcccgaagcgggaatcctcgcggtcggcgagatcaagcgcaagccccgcgtcgtc
accgacgagaccggggccgaatcgatcgagccccgttcggtgatgaccctgtcgctgtcg
ttcgaccaccgactgatcgacggtgccgtcggcgcacagttcacgaatacggtcatggaa
tacctcgagaacccgagcctcctcctgctcgagtaa

DBGET integrated database retrieval system