KEGG   Natrinema sp. J7-2: NJ7G_0215Help
Entry
NJ7G_0215         CDS       T02184                                 

Definition
Protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nat  Natrinema sp. J7-2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(208968..209738)
Genome map
AA seq 256 aa AA seqDB search
MEPAVLREDMVDGLESPPRDVLADEDVAVAMREVPRHAFVDDERTAYADREHAVLGTRVL
APSTVARLLQALALEDDETVLIVGAGVGYTAAVAAELVGETNVHAVDISRPLVVEARDNL
ADAGYDGVLVDCRDGANGFPEYAPFDRILLEAAAVDPPRALLDQRTDAGRLVFPRGTHQQ
RLEVVSADGDVNRLGPVSFAPLLVEGEQSGAVERDRTAREDRERAQRRADSRRGWEQDWI
EWEKTFEQPSRRPRSQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaacccgcggtactgcgagaggatatggtcgacggcctcgagtccccgcccagggat
gtcctcgccgacgaggacgttgccgtcgcgatgcgcgaggtcccgcggcacgcgttcgtc
gacgacgagcgaacggcctacgccgaccgcgaacacgcggtcctcggcacgcgcgttctc
gcgccgagtaccgtcgctcgcttgctccaggcactggcgctcgaggacgacgagaccgtg
ttgatcgtcggtgccggcgtcgggtacacggcggccgtcgcggccgaactcgtcggcgag
acgaacgtccacgccgtcgacatctcccggccgctggtcgtcgaagcgcgggacaacctc
gccgacgcgggctacgacggcgtcctcgtcgactgccgggatggggcgaacggcttcccc
gagtacgcgcccttcgaccgcatcctgctcgaggccgcggccgtcgatccgccgcgtgcg
ctgctcgaccagcgaaccgatgcgggccgactggtcttcccgcgcgggacccaccaacag
cgactcgaggtcgtctcggccgacggcgacgtcaatcgactcggccccgtttcgttcgct
ccgttgctggttgagggtgaacagtcgggggccgtcgagcgcgaccgaacggcccgcgag
gaccgcgaacgggcgcagcgacgcgccgactcccgccgcggctgggaacaggactggatc
gagtgggagaagacgttcgagcagccgtcgcgacggccgcggtcgcagtag

DBGET integrated database retrieval system