KEGG   Natrinema sp. J7-2: NJ7G_0364Help
Entry
NJ7G_0364         CDS       T02184                                 

Definition
Porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nat  Natrinema sp. J7-2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NJ7G_0364
Enzymes [BR:nat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NJ7G_0364
Exosome [BR:nat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NJ7G_0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339290..340303
Genome map
AA seq 337 aa AA seqDB search
MDLTHRPRRLRQDRVRDLVSETRLEPADLIAPVFVDATTDERVPIESMPGHDRVPIDGIV
ARVEEVLETGVEAIMLFGIPESKDPEGSRAWAEDGVVQEAVRRITSETDAYVITDVCLCE
YTDHGHCGPLEEELRSEGGVAANGPACEPTTTVDNDATLAALEKISISHARAGADMVAPS
GMMDGMVGAIRSALDDAGFDHVPIMSYAAKYESAFYGPFRDAADGAPAFGNRRHYQMDPA
NSREAMREVQLDAEQGADVMLVKPALPYLDIISTVRREFDHPVAAYNVSGEYAMLHAAAE
KGWLDLEAVATESLLSIKRAGADVIVTYFAEDVAQQL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatctcacccatcgcccccggcggctccgacaggatcgcgttcgcgacctcgtcagc
gagacgcgcctcgagcccgccgatctcatcgcgccggtgttcgtcgatgcgacgaccgac
gagcgcgtccccatcgagtcgatgcccggccatgatcgcgtgccgatcgacgggatcgtc
gcccgcgtcgaggaggtcctcgagaccggcgtcgaggcgatcatgctctttggtatcccg
gaatcgaaggatcccgaggggagccgcgcctgggccgaggacggcgtcgtgcaggaggcg
gtgcgacggatcaccagcgagacggacgcctacgtcattaccgacgtgtgcctctgtgag
tacaccgatcacggtcactgcggcccgctcgaagaggagctacgcagcgagggcggggtc
gctgcgaacggaccggcctgcgaaccgacgacgaccgtggacaacgacgcgacgctcgcg
gcactcgagaagatcagtatctcacacgctcgtgcgggcgctgatatggtcgccccgagc
gggatgatggacgggatggtcggggccatccggtcggcgcttgacgacgcgggattcgac
cacgtcccgatcatgagctacgcggccaagtacgagagcgcgttctacggcccgttccgg
gacgccgccgacggcgcgcccgcgttcgggaaccgccggcactaccagatggatcccgcg
aattcgcgagaagccatgcgggaggtccaactggacgccgaacagggtgcggacgtgatg
ctggtcaaacccgcactcccgtatctcgacatcatcagcaccgtccgccgcgagttcgac
caccccgtcgccgcctacaacgtctccggcgagtacgccatgcttcacgccgccgccgag
aagggctggctcgacctcgaggcagtcgccacggaatcgctgctgtcgatcaagcgggca
ggtgcggatgtaatcgtgacgtacttcgccgaagacgttgcacagcagctgtag

DBGET integrated database retrieval system