KEGG   Natrinema sp. J7-2: NJ7G_0424Help
Entry
NJ7G_0424         CDS       T02184                                 

Definition
alcohol dehydrogenase GroES domain protein
Organism
nat  Natrinema sp. J7-2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396937..397287
Genome map
AA seq 116 aa AA seqDB search
MIADLTDDEGAKQVVDFVGRDETTALAPDIVAAGGNHHIVGYGGHVHEPSQALVNGEFSF
RGTLVGKYAELQALVALVERGDVELRTERHDRGEINTVAERLEHNEIEGRAVIQPP
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcggacctgaccgacgacgagggggccaagcaggtcgtcgacttcgtcggccgc
gacgagacgaccgcgctcgcacccgacatcgtcgccgccgggggcaatcaccacatcgtc
ggctacggcgggcacgttcacgaacccagtcaggcgctggtcaacggcgagttctcgttc
cgcggcacgctcgtcggcaagtacgccgagttacaggcgctcgtcgcgctcgtcgagcgg
ggcgatgtcgaactgcgcaccgaacgccacgaccgcggcgagatcaacacggtcgcggaa
cggctcgagcacaacgaaatcgagggccgcgcggtgatccagccgccctga

DBGET integrated database retrieval system