KEGG   Natrinema sp. J7-2: NJ7G_0424Help
Entry
NJ7G_0424         CDS       T02184                                 

Definition
alcohol dehydrogenase GroES domain protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:nat01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nat00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:nat00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:nat00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:nat00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:nat00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396937..397287
Genome map
AA seq 116 aa AA seqDB search
MIADLTDDEGAKQVVDFVGRDETTALAPDIVAAGGNHHIVGYGGHVHEPSQALVNGEFSF
RGTLVGKYAELQALVALVERGDVELRTERHDRGEINTVAERLEHNEIEGRAVIQPP
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcggacctgaccgacgacgagggggccaagcaggtcgtcgacttcgtcggccgc
gacgagacgaccgcgctcgcacccgacatcgtcgccgccgggggcaatcaccacatcgtc
ggctacggcgggcacgttcacgaacccagtcaggcgctggtcaacggcgagttctcgttc
cgcggcacgctcgtcggcaagtacgccgagttacaggcgctcgtcgcgctcgtcgagcgg
ggcgatgtcgaactgcgcaccgaacgccacgaccgcggcgagatcaacacggtcgcggaa
cggctcgagcacaacgaaatcgagggccgcgcggtgatccagccgccctga

DBGET integrated database retrieval system