KEGG   Natrinema sp. J7-2: NJ7G_0552Help
Entry
NJ7G_0552         CDS       T02184                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_0552
   00030 Pentose phosphate pathway
    NJ7G_0552
   00051 Fructose and mannose metabolism
    NJ7G_0552
   00052 Galactose metabolism
    NJ7G_0552
   00500 Starch and sucrose metabolism
    NJ7G_0552
   00520 Amino sugar and nucleotide sugar metabolism
    NJ7G_0552
  Nucleotide metabolism
   00230 Purine metabolism
    NJ7G_0552
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NJ7G_0552
Enzymes [BR:nat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NJ7G_0552
    5.4.2.8  phosphomannomutase
     NJ7G_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
507218..508594
Genome map
AA seq 458 aa AA seqDB search
MQVFGSSGTRGVANEELTPAFVLRVAKAAGTTWGDGHGGDRVAIARDTRHTGRMLADAAA
SGMASTGTDVDRLGIVPTPGAQAYAEREGVPVIVITASHNPPPYNGVKLVGADGVELSIA
DLESIEETLLAESFTVAPWNETGRVREIDGVTQAYVDELLAAADRDRIADADLTVALDPG
HGAGSLTSPEFFRKLGCRVVTVNAQPDGHFPGRDPEPVPDNLTDLGRLVRATDADIGIAH
DGDADRAIFFDETGAYVEGDATLAALAAAELEAGDTTVSAVNVSQRLVDVVTEVGADLEL
TPIGSTNIITRIEELEENGERVPVAGEGNGGIFFPDYRLSRDGAFTAARFLELVAERPVS
EIVAPYGGYVNVRHNVEYESTAERDAMLDAAANQAQAADADLNTRDGYRLDYGDAWVLAR
PSGTEPLVRIYAEARDGDRAEELASDMHDALAAAKADI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcttcggatcgagtgggacgcggggcgtcgccaacgaggagttgacgcccgcg
ttcgtcttgcgcgtcgcgaaagcggcggggacgacttggggagacgggcacggtggggac
cgagtggccatcgcccgcgacactcgccataccgggcggatgctggccgacgcggccgcg
agcgggatggcgagtaccggtaccgatgtcgaccgcctcggaatcgtcccgacgccaggc
gcacaagcctacgccgaacgggaaggcgtcccagtaatcgtcatcacggcctcgcacaac
ccgccgccgtacaacggcgtcaaactcgtcggtgccgatggcgtggagctctcgatcgcc
gacctcgagtccatcgaggagacactgctcgccgaatcgttcaccgtcgccccctggaac
gagaccggccgcgttcgcgagatcgacggcgtgacgcaggcgtacgtcgacgaactgctc
gcggccgccgatcgcgaccggatcgccgacgccgacctcaccgtcgcgctcgatccgggt
cacggcgcgggatcgctgaccagccccgagttcttccggaaactcggttgtcgagtggtc
acggtcaacgcccagcccgacggccacttcccgggtcgggaccccgagccggtccccgac
aacctcaccgatctcggccgcctcgtccgtgcgaccgacgccgacatcggcatcgctcac
gacggcgacgccgatcgcgccattttcttcgacgagaccggcgcgtacgtcgagggcgat
gccacgctcgccgcgctcgcagccgccgaactcgaggccggcgacaccaccgtctcggcg
gtcaacgtctcccagcgactcgtcgatgtcgtcaccgaggtcggggccgacctcgagttg
accccgatcggctcgacgaacatcatcacccggatcgaggaactcgaggaaaacggcgag
cgggtgcccgtcgcgggcgagggcaacggcgggatcttcttccccgattaccggctctcg
cgagacggtgccttcacggccgcgcgcttcctcgagttggttgccgagcgacccgtcagc
gagatcgtcgcgccctacggcggctacgtcaacgtccgccacaacgtcgagtacgaatcg
acggccgagcgcgacgcgatgctcgacgcggcggccaatcaggcccaggccgccgacgcg
gacctcaacacgcgtgacggctaccggctggattacggcgacgcgtgggtgcttgcccgc
ccgtccggaaccgaaccgctcgtccggatctacgctgaggcccgcgacggtgaccgcgcc
gaggaactcgccagtgacatgcacgatgcgctggccgccgcgaaggccgacatctga

DBGET integrated database retrieval system