KEGG   Natrinema sp. J7-2: NJ7G_0774Help
Entry
NJ7G_0774         CDS       T02184                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_0774
   01230 Biosynthesis of amino acids
    NJ7G_0774
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_0774
   00051 Fructose and mannose metabolism
    NJ7G_0774
   00562 Inositol phosphate metabolism
    NJ7G_0774
Enzymes [BR:nat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NJ7G_0774
Exosome [BR:nat04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NJ7G_0774
  Exosomal proteins of bladder cancer cells
   NJ7G_0774
  Exosomal proteins of melanoma cells
   NJ7G_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
705458..706102
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKTYPCDPVEVAAAVRDVNDATDARLAVAPQAAHIERVAETGVETWAQHVDAIE
YGSNTGHALAESVADAGAVGTLINHSERRLKLADIDGAVRAAKRADLETVVCANNPAQIG
AAAALGPDAVAVEPPALIGTGTPVSQADPDVVENAVEAAANVDSSVSVLCGAGISTGDDV
VAAGDLGAEGVLLASGVAKADDPQSALEDLVEPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcctcgttaatctgaagacgtatccgtgtgacccggtcgaagttgcggcggcc
gttcgcgacgtcaacgacgccactgacgctcgtctagccgtcgcaccgcaggcggcccat
atcgagcgcgtcgccgaaacgggtgtggagacgtgggcacagcacgtcgacgcgatcgaa
tacgggagcaacaccgggcacgcgctcgccgagagcgtcgccgacgccggcgcggtcggc
acgctgatcaatcactccgagcggcggctgaaactggccgacatcgacggtgccgtccgt
gcggccaagcgggcggatctcgagacggtcgtctgtgcgaacaacccggcccagatcggc
gcggccgccgcgctggggccggacgccgtcgccgtcgaaccgcccgccctcatcggtacc
gggacgccggtcagtcaggccgatcccgacgtcgtcgagaacgccgtcgaggcggcagcg
aacgtcgattcttcggtgtcggtcctctgtggtgcgggcatcagtacgggtgacgacgtc
gtcgccgcgggcgatctgggtgccgaaggcgtcctgctcgccagcggggtcgcgaaggcc
gacgatccgcaatcggcgctcgaggacctcgtcgaaccgctctga

DBGET integrated database retrieval system