KEGG   Natrinema sp. J7-2: NJ7G_0823Help
Entry
NJ7G_0823         CDS       T02184                                 

Definition
succinyl-CoA ligase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nat  Natrinema sp. J7-2
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_0823
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NJ7G_0823
   00640 Propanoate metabolism
    NJ7G_0823
   00660 C5-Branched dibasic acid metabolism
    NJ7G_0823
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NJ7G_0823
Enzymes [BR:nat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NJ7G_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(746427..747578)
Genome map
AA seq 383 aa AA seqDB search
MKLHEYQAKTVFADAGIPTPDSQLASDVDGVISAAEEIGYPVAVKAQVQVGGRGKAGGIK
LVEDADEARDAADSILGMDLKGYHVDRVLVEEAVDFVNELYVGITMDRGEGKPVAMVSTK
GGVNIEEVAEEDPDAIAREHIDPSFGMHPYQARKAVYDAGVDQSVARDVSSVLTTLYQLW
DDKDGADAEINPLMVTADDEVIAADAVMNIDEDALFRQPELAEMEEEAAGGDDLEQKADE
YGFDYVRLDGNTGIIGNGAGLVMTTLDLVDHYGGEPANFLDVGGGAKAARIANALDMVFS
DDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNEDLV
TVEQTLEDAVQRAVEYAGEVNDQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatatcaggcgaagaccgtcttcgccgatgccgggattccgacgccg
gactcgcaactcgcgtccgacgtcgacggtgtgatatccgcggccgaggaaatcggatac
ccagtagcggtgaaagcgcaggtacaggtcggcggccgtgggaaggccggcggaattaag
ctcgtcgaggacgcggacgaggcccgggacgcggccgactccattctcggcatggatctg
aaagggtatcacgtcgatcgggtcctcgtcgaggaagcggtcgacttcgtgaacgaactc
tacgtggggatcacgatggaccgcggcgagggcaagcccgtcgcgatggtctcgaccaaa
ggcggcgtcaacatcgaggaagtcgccgaggaagatcccgacgcgatcgcccgcgaacac
atcgatccctccttcgggatgcacccataccaggcccgcaaggccgtctacgacgccggc
gtcgaccagtcggtcgcgcgcgacgtctcgagcgtcctcaccacgctctaccagctctgg
gacgacaaagacggagccgacgccgagatcaacccgctgatggtcacggccgacgacgag
gtcatcgcggccgacgctgtgatgaacatcgacgaggacgccctgttccgccagcccgaa
ctcgccgagatggaagaggaagcggccggcggcgacgatctcgagcagaaggccgacgag
tacggcttcgactatgtccgtctcgatggcaacacggggatcatcggcaacggtgccggg
ctcgtgatgacgacgctcgacctggtcgaccactacggcggcgaacccgccaacttcctc
gacgtgggcggcggcgcgaaggccgcccgcatcgcgaacgcgcttgacatggtcttctcc
gacgacaacgtcgattcggtcgtcttcaacatcttcggcgggatcacccgcggcgacgag
gtcgcccgggggatcaacgaggcgctcgagcagttcgatgagatccccaagccggtcgtc
gtccgactggccggcacgaactgggaggaaggcatggagattctcaacgaggacctcgtg
acggtcgaacagaccctcgaggacgcggttcagcgtgctgtcgagtacgctggggaggtg
aacgaccaatga

DBGET integrated database retrieval system