KEGG   Natrinema sp. J7-2: NJ7G_0823Help
Entry
NJ7G_0823         CDS       T02184                                 

Definition
(GenBank) succinyl-CoA ligase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nat  Natrinema sp. J7-2
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_0823
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NJ7G_0823
   00640 Propanoate metabolism
    NJ7G_0823
   00660 C5-Branched dibasic acid metabolism
    NJ7G_0823
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NJ7G_0823
Enzymes [BR:nat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NJ7G_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(746427..747578)
Genome map
AA seq 383 aa AA seqDB search
MKLHEYQAKTVFADAGIPTPDSQLASDVDGVISAAEEIGYPVAVKAQVQVGGRGKAGGIK
LVEDADEARDAADSILGMDLKGYHVDRVLVEEAVDFVNELYVGITMDRGEGKPVAMVSTK
GGVNIEEVAEEDPDAIAREHIDPSFGMHPYQARKAVYDAGVDQSVARDVSSVLTTLYQLW
DDKDGADAEINPLMVTADDEVIAADAVMNIDEDALFRQPELAEMEEEAAGGDDLEQKADE
YGFDYVRLDGNTGIIGNGAGLVMTTLDLVDHYGGEPANFLDVGGGAKAARIANALDMVFS
DDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNEDLV
TVEQTLEDAVQRAVEYAGEVNDQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatatcaggcgaagaccgtcttcgccgatgccgggattccgacgccg
gactcgcaactcgcgtccgacgtcgacggtgtgatatccgcggccgaggaaatcggatac
ccagtagcggtgaaagcgcaggtacaggtcggcggccgtgggaaggccggcggaattaag
ctcgtcgaggacgcggacgaggcccgggacgcggccgactccattctcggcatggatctg
aaagggtatcacgtcgatcgggtcctcgtcgaggaagcggtcgacttcgtgaacgaactc
tacgtggggatcacgatggaccgcggcgagggcaagcccgtcgcgatggtctcgaccaaa
ggcggcgtcaacatcgaggaagtcgccgaggaagatcccgacgcgatcgcccgcgaacac
atcgatccctccttcgggatgcacccataccaggcccgcaaggccgtctacgacgccggc
gtcgaccagtcggtcgcgcgcgacgtctcgagcgtcctcaccacgctctaccagctctgg
gacgacaaagacggagccgacgccgagatcaacccgctgatggtcacggccgacgacgag
gtcatcgcggccgacgctgtgatgaacatcgacgaggacgccctgttccgccagcccgaa
ctcgccgagatggaagaggaagcggccggcggcgacgatctcgagcagaaggccgacgag
tacggcttcgactatgtccgtctcgatggcaacacggggatcatcggcaacggtgccggg
ctcgtgatgacgacgctcgacctggtcgaccactacggcggcgaacccgccaacttcctc
gacgtgggcggcggcgcgaaggccgcccgcatcgcgaacgcgcttgacatggtcttctcc
gacgacaacgtcgattcggtcgtcttcaacatcttcggcgggatcacccgcggcgacgag
gtcgcccgggggatcaacgaggcgctcgagcagttcgatgagatccccaagccggtcgtc
gtccgactggccggcacgaactgggaggaaggcatggagattctcaacgaggacctcgtg
acggtcgaacagaccctcgaggacgcggttcagcgtgctgtcgagtacgctggggaggtg
aacgaccaatga

DBGET integrated database retrieval system