KEGG   Natrinema sp. J7-2: NJ7G_0853Help
Entry
NJ7G_0853         CDS       T02184                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nat  Natrinema sp. J7-2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nat01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nat00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775143..776063
Genome map
AA seq 306 aa AA seqDB search
MERTVRIIGAPMDYGANRRGVDMGPSAIRYADLADGLERAGVDPIDDGDLTMPRAEERDP
DADQPRRGDAKFLREIEDVCKRVRDRVATTLADGEFPLVLGGDHSVAIGSLTGSARDADL
GAIWFDAHADLNTPETSPSGNVHGMPLAAALGRGAFGETEWAPAPRLQESSIAYVGLRSI
DDRERELIRESEITAFTMADIDQRGISAVVDDALAVATDGTDGVHVSLDLDWLDPKTAPG
VGTPVRGGVTYREAHAALETLSRRDEAEGILRSMDVVEVNPILDEGNETATLAAELTAST
FGKRIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaacggaccgtcagaatcatcggggcaccgatggactacggagcgaaccgccgcggc
gtcgacatgggaccgtcagcgattcgatacgcggacctcgcggacggcctcgagcgagca
ggcgtcgacccgatcgatgacggcgacttgacgatgccgcgggccgaagagcgcgatccg
gacgccgatcagcccagacggggggacgcgaagttcctccgggagatcgaggacgtctgt
aagcgggtgcgcgatcgggtcgcgacaacgctcgcggacggcgagttcccgctcgtgctg
ggcggggatcattcggtcgcgatcgggtcgctgactggttcggcacgcgacgccgacctc
ggggcgatctggttcgacgcccacgccgacctcaacacgcccgaaacctctcccagcggg
aacgtccacgggatgccgctggccgccgccctcggccgcggcgcgttcggcgaaacggag
tgggcacctgcgcctcggctccaggagtcgtcgatcgcttacgtcggactccggagcatc
gacgaccgcgagcgcgaactgatccgtgaaagcgagatcaccgccttcaccatggccgac
atcgatcagcggggcatctccgcggtcgtcgacgacgccctcgcggtcgcgaccgacggc
accgacggcgtccacgtgagcctcgacctcgactggctcgatcccaagacggcacccggg
gttggcactcccgtccgcggcggtgtcacctaccgggaagcccacgccgcgctcgagacg
ctgtcccgacgcgacgaggcggaggggatcctccgatcgatggacgtcgtcgaagtgaac
ccaatcctagacgaggggaacgaaacggcgacgctagcggcggagctaacggccagcacg
ttcggcaaacgaatcctctga

DBGET integrated database retrieval system