KEGG   Natrinema sp. J7-2: NJ7G_0876Help
Entry
NJ7G_0876         CDS       T02184                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nat  Natrinema sp. J7-2
Brite
Enzymes [BR:nat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NJ7G_0876
Transfer RNA biogenesis [BR:nat03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NJ7G_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(795487..797148)
Genome map
AA seq 553 aa AA seqDB search
MSTETPEPTETEAFERVCETLVERILAGEVERDEVEKAKLEACSEHSAPKVPKNSELLDY
APEEHREDLETVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQSYTG
EEPAAARGVQNEYDPYGQVTLRLEQLRQIGHPVDKVELILMGGTMTARSHDYQEWFVKRA
LEAMNDYDVDKEPEPAQGVSFAEDPEAYEWKYLEDVIAENETADIRNIGTTFETKPDWCD
PEQIDRMLDLGGTKVEVGVQTTYERINRDMHRGHGAQASIDANQRLRDSAFKVGFHMMPG
QPGMSKEMCLEDFRRLFEEEQWKPDYLKIYPTLVVRGTATYDWWHKDEYEPLSNDEAADL
IAEIKDMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARKRMDEHGWECECIRCREAGM
HDDEPETVDLDVMRYEACGGTEHFISVEDFEKDLLVGFCRLRFPNDPVRPELENAALVRE
LHVYGSEVAMGDESETDQHQHQGYGRRLMARAEELAADAGYDKVSVISGIGAREYYRNKL
GYHQDGPYVSKRL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgccagaaccgaccgaaaccgaagcgttcgagcgggtctgtgagacg
ctcgtcgagcggatcctcgccggcgaggtcgagcgcgacgaggtcgagaaagccaaactc
gaggcctgttcggaacactcagcacccaaggtgccgaagaactccgagttgctggactac
gcgcccgaggagcaccgggaggacttggagaccgtgctccagcgcaagccggtccggacg
gcctccggcgtctcgccggtcgcgatcatgacctcgcccgagcggtgtccccacggcaag
tgtctctactgccccggcggccccgactccgagttctcctcatcgcagagttacaccggc
gaggagcccgccgccgcccgcggcgtccaaaacgagtacgatccctacggccaggtgacg
ctgcgactcgagcaactgcgccagatcggccaccccgtcgacaaggtcgaactgatcctg
atgggtgggacgatgaccgcccgcagccacgactatcaggagtggttcgtcaagcgagcc
ctcgaggcgatgaacgactacgacgtcgacaaagagcccgagccggcacagggggttagc
ttcgccgaagatcccgaggcgtacgagtggaaatacctcgaggacgtcatcgccgaaaac
gagaccgcggacatccgcaacatcgggacgacgttcgagacgaaacccgactggtgtgac
cccgaacagatcgaccgaatgctcgatctcggcggcaccaaagtcgaggtgggggtacag
acgacctacgagcggatcaaccgcgacatgcaccgcggccacggcgcacaggcctcgatc
gacgccaaccagcggctgcgcgactcggcgttcaaagtgggctttcacatgatgccgggc
cagccggggatgagcaaggagatgtgtctcgaggacttccgacgcctcttcgaggaagag
cagtggaagcccgactacctgaagatctatccgacgctcgtggtgcggggcactgcgacc
tacgattggtggcacaaagacgagtacgagcccctctcgaacgacgaagcggcggatctg
atcgcggagatcaaggacatgatcccccggtacacgcggctccagcgcgtccagcgggac
atcccggcggacttcatcgatgctggcgtctggaagtcgaacctccggcagctcgcgcgc
aagcgcatggacgaacacggctgggagtgtgagtgcatccgctgtcgtgaggccgggatg
cacgacgacgaacccgaaacagtcgatctcgacgtgatgcgctacgaggcctgtggcggc
accgagcacttcatttccgtcgaggacttcgagaaggacctgctggtcggcttctgccga
ctccggttccccaacgaccccgttcggccggagctcgagaacgcggcgctggtccgggaa
ctccacgtttacgggtcggaagtcgcgatgggcgacgaaagcgagacggaccaacaccag
catcaggggtacggccgccggctgatggcccgcgccgaggaactcgccgccgacgccggc
tacgacaaggtcagcgtgatctccggcatcggcgcgcgggagtactaccggaacaagctc
ggctaccatcaggacggaccgtacgtcagcaagcgactctga

DBGET integrated database retrieval system