KEGG   Natrinema sp. J7-2: NJ7G_1387Help
Entry
NJ7G_1387         CDS       T02184                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
nat  Natrinema sp. J7-2
Brite
Enzymes [BR:nat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     NJ7G_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1234431..1235411)
Genome map
AA seq 326 aa AA seqDB search
MTGTLEPGTAAVTGATGFLGSRLCTRLLEDGWTVRGLSRPTSDRGDLSGVDWFVGDIFDG
ETLRELVDGADVVFHLAGVGLWSADPETVWAVNRDGTERVLEACRDGDVGRVVFTSTAGT
RRPQGDDAVADETDVAEPIGAYQAAKAQAATLVDQYADAGGDAVTVHPTSIFGPGDEAFT
AQLLSMGVDLTMPAHLPGGLSIVGVSDVVDGLLAAADRGTSGDHYILGGENLTYDSAVSR
IANAVDGSPARIRVPATAIHAAGPVAEVVDAVADRRVFPFDRDMARLATQRLFYSSKKAS
EELGYEYQPLEAHLPETMAWYRTAVR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaacgctcgagccggggacggcggcggtcaccggggcgaccgggttcctcggc
tcgcggctctgtacccgcctgctcgaggatggctggacggtgcgcggactcagtcggccg
acctcggatcgaggcgatctcagcggcgtcgactggttcgtcggcgatatcttcgacggc
gagacgctgcgggagctcgtcgacggggctgatgtcgtcttccacctcgcgggggtcggc
ctctggagcgccgaccccgagaccgtctgggcggtcaaccgcgacggcacggaacgggtg
ctcgaggcctgtcgcgacggcgacgttggacgcgtggtgttcaccagtaccgccggaacg
cgccgtccgcagggagacgacgccgtcgcggacgagacggacgtggccgagccgatcggg
gcctatcaggccgcgaaagcccaagcggcgaccctggtcgatcagtacgccgacgctggc
ggggacgccgtgaccgttcacccgacgtcgatcttcggccccggcgacgaggcgttcacc
gcccaactgctttcgatgggcgtcgatctgacgatgcccgcccacctccccggcggcctg
agcatcgtcggcgtctcggacgtcgtcgacggcctcctggccgcggccgaccgcggaacc
agcggcgaccactacatcctcggcggcgagaacctcacctacgacagcgccgtctcccgg
atcgccaacgccgtcgacggctcgcccgcccgcatccgcgttcccgcgacggcgatccac
gctgccggccccgtcgcggaagtcgtcgacgccgtcgccgaccggcgcgtgttccccttc
gatcgagacatggcccgtctcgcaacccagcggctgttctacagttcgaagaaagccagc
gaggaactggggtacgagtaccagccgctcgaggcccacctgcccgagaccatggcgtgg
tatcgaacggcagtcaggtag

DBGET integrated database retrieval system