KEGG   Natrinema sp. J7-2: NJ7G_1713Help
Entry
NJ7G_1713         CDS       T02184                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nat00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1524354..1525895)
Genome map
AA seq 513 aa AA seqDB search
MTNNTYVGAVDQGTTGTRFIVFDHEGQVVANAYEKHEQIYPEPGWVEHDPTEIWENTKDV
IRRALGQAGVSPDQLEAIGVTNQRETTLLWDADSGRPVHNAIVWQDRRTTDRVEQLEEDG
FVETIREKTGLEADAYFSATKAEWLLDNADPIKLERSRPEDIRDRAEKGEVLFGTIDTWL
IYNLTGEHITEVTNASRTMLYNIHDLEWDDDLLAEFDVPETMLPEVRPSSDDATYGSTDP
DGFLEAEVPVAGALGDQQAALFGQTCFDAGDAKNTYGTGSFFLMNTGDEAVESDHGLLTT
IGFQRSGEDVQYALEGSIFITGAAIEWLEDMSLIDNPAQTAELARSVDSTDGVYVVPAFT
GLGAPHWDQRARGTIVGMTRGTRREHVVRATLESIAYQTRDVAEAMEADSGIEMTSLKVD
GGAVKNNFLCQLQSDIIGSEIVRPVVDETTALGSAYAAGLAVGYWSDPDELRSNWQVDAE
FEPKMDRAVADKRYDRWSDAVERARDWARDGEE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataatacctatgtcggtgcggttgaccagggaacgaccggcacgcgctttatc
gtgttcgatcacgaggggcaagttgtcgcgaacgcgtacgaaaaacacgaacagatctat
ccggaacccggctgggtcgagcacgatccgaccgaaatctgggagaacaccaaagacgtc
attcgacgggcgctcggacaggcgggcgttagccccgaccaactcgaggccatcggcgtg
accaaccagcgggagacgacgttgctgtgggacgccgactccggtcggccggtccacaac
gccatcgtctggcaggaccgtcgcacgaccgaccgcgtcgaacaactcgaggaggacggc
ttcgtcgagaccatccgcgagaagaccgggctcgaggccgacgcctacttctcggcgacg
aaagccgaatggctgctcgacaacgccgacccgatcaaactcgagcgctcccggccggag
gacatccgcgaccgcgcagagaaaggcgaggtcctcttcgggaccatcgacacgtggctg
atctacaacctcaccggtgagcacatcaccgaagtcacgaacgcctcgcgaacgatgctg
tacaacatccatgacctcgagtgggacgacgacctcctcgcggagttcgacgttcccgaa
acgatgctccccgaggtacgcccctcgagcgacgacgcgacctacggttcgaccgatccg
gatgggttcctcgaagccgaggttccggtcgcgggcgcgctcggcgatcaacaggcggcc
ctgttcggccagacctgtttcgacgccggcgacgcgaagaacacctacggaactggctcg
ttcttcctgatgaacaccggcgacgaggccgtcgaatccgaccacggcctgctgacgacg
atcggcttccagcgctcgggtgaagacgtccagtacgcactcgaggggtcgatcttcatc
accggcgcggcgatcgagtggctcgaggatatgtcgctgatcgacaaccccgcccagacg
gcggagctcgcccgcagcgtcgactcgacggacggcgtctacgtcgtccccgcctttacc
gggctgggcgcaccccactgggatcagcgcgcacgcggcaccatcgtcgggatgacccgt
ggcacgcggcgggaacacgtcgttcgcgcgaccctcgagtcgatcgcctaccagacccgg
gacgtcgcggaggcgatggaagccgactcgggcatcgaaatgacgtcgttgaaggttgac
ggcggcgcggtcaagaacaacttcctctgtcagctacagtccgacatcatcggctcggag
atcgtccgcccggtcgtcgacgagacgacggcgctcggctccgcgtacgcggccggcctc
gccgtcgggtattggagcgatcccgacgagttacgcagcaactggcaggttgacgcggag
ttcgaaccgaagatggatcgggcggtcgcggacaagcggtacgatcggtggtcggacgcc
gtcgaacgagcacgtgactgggcgcgagatggggaggagtaa

DBGET integrated database retrieval system