KEGG   Natrinema sp. J7-2: NJ7G_1893Help
Entry
NJ7G_1893         CDS       T02184                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_1893
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_1893
   00620 Pyruvate metabolism
    NJ7G_1893
   00640 Propanoate metabolism
    NJ7G_1893
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NJ7G_1893
   00680 Methane metabolism
    NJ7G_1893
Enzymes [BR:nat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NJ7G_1893
Lipid biosynthesis proteins [BR:nat01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NJ7G_1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1666595..1668433)
Genome map
AA seq 612 aa AA seqDB search
MYYDVCTENRCVYANRYRERVCNFNVRIQCYAIVGAEFTGTAIYGEGIAGRCMVSSHNLS
DYEAEREQFSWDDIYAAADWDAPGQLNIAHEVADRHATERETVALYQVGTDGELTKMTFW
ELADRSSQFANVLEGLGVEQGDRVFSYMPRIPEHYVAMVGTLKRGAVWGSVNERFGPDGI
SYRLDDCDAKVLVTTTDNRETVADALADAPTVEHVITVDRGGGAPADDVVFNTALDGAST
DYETADTGGEDDALLYYTSGTTGLAKGVRHKQRWVAGVAATQRYTVDLQPGDLYWSTGDL
GWLTGVINTLGAWFWGASLFTYEGEFDPETWAALLDEYPITVLFSVPTAYRMLRENESVL
ADVDLELRHALSIGEPLSAGVVDWGEDELGVTILDTYGQTETGNMIINNYPTMELRPGSM
GKPLPGIEADIVDPETGAVLEPGETGEIAQRGDYPCFFDEYWQKPDKTASCFVDGPDGEW
YLSGDLAHKDEDGYFWFEGRADDVILSSGYRIGPFEVESSLGEHEAVAEAAVVPKPHMER
GNIVKAYVVPSEGTTPSADLKEDIRTHVRDELSAHEYPREIEFREELPKTVTGKIRRTEL
QDDAEEETETST
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgacgtatgtactgaaaacagatgcgtttacgcaaaccggtaccgtgaacga
gtctgtaatttcaatgttcgtatccaatgttatgctattgttggtgcagaatttaccggt
acagctatatacggtgaagggattgcggggcggtgtatggtgtccagccacaatctgtcc
gactacgaggccgaacgggagcagttctcgtgggacgacatctacgcggcagccgactgg
gacgcaccagggcaactcaacatcgcacacgaggtcgccgatcggcacgcgaccgaacgc
gagacggtcgcgctctatcaggtcgggaccgacggggagttgaccaagatgaccttctgg
gagctggccgatcgctcgagccagttcgcgaacgttctcgaagggctgggcgtcgaacag
ggtgaccgcgtgttctcgtatatgccacgaattcccgaacactacgtggcgatggtgggg
acgctgaagcggggggccgtctgggggagcgtcaacgagcggttcggaccggacggcatc
tcctatcggctcgacgactgcgacgcgaaagtgctcgtgacgacgaccgacaaccgcgag
acggtcgcggacgcgctcgcggacgcgccgacggtcgaacacgttatcacggtcgaccgc
ggcggcggcgcgcccgcggacgatgtcgtcttcaatacggcactcgacggcgcgagtacg
gactacgagaccgccgacaccggcggcgaggacgacgccttgctctattacacgtcgggg
acgaccgggttggcgaagggcgtccgccacaaacagcgatgggtggccggcgtggcggcg
acccagcggtacaccgtcgatctccagcccggtgacctctactggagtacgggcgatctg
ggctggctgaccggcgtgatcaacacgctcggggcctggttctggggtgcttcgctgttc
acctacgagggcgagttcgaccccgaaacatgggcggccctgctcgacgaatatccgatc
accgtgctgttctcggtgccgacggcctatcggatgctccgcgagaacgagtccgtcctc
gccgatgtcgacctcgagctgcgacacgcgctctcgatcggcgagccactcagcgccggc
gtcgtcgactggggggaggacgaactcggcgtcaccatcctcgacacctacggccagacg
gagacgggcaacatgatcatcaacaactacccgacgatggagctgcgacccggctcgatg
ggcaagccgctccctggcatcgaggccgacatcgtcgaccccgaaaccggtgccgtgctc
gagcccggtgaaacgggtgagatcgcccagcgcggggactatccctgcttcttcgacgaa
tactggcagaaaccggacaagaccgcgtcgtgtttcgtcgacggaccggacggggagtgg
tacctctcgggggatctcgcgcacaaggacgaggacggctacttctggttcgaggggcgt
gcggacgacgtcatcctgtcctcgggctaccggatcggcccgttcgaggtcgagagttcg
ctgggcgaacacgaggccgtcgccgaggcggccgtcgtgcctaaaccccacatggagcgg
ggcaacatcgtgaaggcctacgtcgtgccaagcgagggcacaacgccgtccgcggacctc
aaggaggacatcaggacccacgtgcgcgacgagctctcggcccacgagtacccccgggag
atcgagttccgcgaggaactgccgaagacggtcaccgggaagatccgtcgaaccgaactc
caagacgacgcggaagaagagaccgagacatcgacgtaa

DBGET integrated database retrieval system