KEGG   Natrinema sp. J7-2: NJ7G_1893Help
Entry
NJ7G_1893         CDS       T02184                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_1893
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_1893
   00620 Pyruvate metabolism
    NJ7G_1893
   00640 Propanoate metabolism
    NJ7G_1893
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NJ7G_1893
   00680 Methane metabolism
    NJ7G_1893
Enzymes [BR:nat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NJ7G_1893
Lipid biosynthesis proteins [BR:nat01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NJ7G_1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1666595..1668433)
Genome map
AA seq 612 aa AA seqDB search
MYYDVCTENRCVYANRYRERVCNFNVRIQCYAIVGAEFTGTAIYGEGIAGRCMVSSHNLS
DYEAEREQFSWDDIYAAADWDAPGQLNIAHEVADRHATERETVALYQVGTDGELTKMTFW
ELADRSSQFANVLEGLGVEQGDRVFSYMPRIPEHYVAMVGTLKRGAVWGSVNERFGPDGI
SYRLDDCDAKVLVTTTDNRETVADALADAPTVEHVITVDRGGGAPADDVVFNTALDGAST
DYETADTGGEDDALLYYTSGTTGLAKGVRHKQRWVAGVAATQRYTVDLQPGDLYWSTGDL
GWLTGVINTLGAWFWGASLFTYEGEFDPETWAALLDEYPITVLFSVPTAYRMLRENESVL
ADVDLELRHALSIGEPLSAGVVDWGEDELGVTILDTYGQTETGNMIINNYPTMELRPGSM
GKPLPGIEADIVDPETGAVLEPGETGEIAQRGDYPCFFDEYWQKPDKTASCFVDGPDGEW
YLSGDLAHKDEDGYFWFEGRADDVILSSGYRIGPFEVESSLGEHEAVAEAAVVPKPHMER
GNIVKAYVVPSEGTTPSADLKEDIRTHVRDELSAHEYPREIEFREELPKTVTGKIRRTEL
QDDAEEETETST
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgacgtatgtactgaaaacagatgcgtttacgcaaaccggtaccgtgaacga
gtctgtaatttcaatgttcgtatccaatgttatgctattgttggtgcagaatttaccggt
acagctatatacggtgaagggattgcggggcggtgtatggtgtccagccacaatctgtcc
gactacgaggccgaacgggagcagttctcgtgggacgacatctacgcggcagccgactgg
gacgcaccagggcaactcaacatcgcacacgaggtcgccgatcggcacgcgaccgaacgc
gagacggtcgcgctctatcaggtcgggaccgacggggagttgaccaagatgaccttctgg
gagctggccgatcgctcgagccagttcgcgaacgttctcgaagggctgggcgtcgaacag
ggtgaccgcgtgttctcgtatatgccacgaattcccgaacactacgtggcgatggtgggg
acgctgaagcggggggccgtctgggggagcgtcaacgagcggttcggaccggacggcatc
tcctatcggctcgacgactgcgacgcgaaagtgctcgtgacgacgaccgacaaccgcgag
acggtcgcggacgcgctcgcggacgcgccgacggtcgaacacgttatcacggtcgaccgc
ggcggcggcgcgcccgcggacgatgtcgtcttcaatacggcactcgacggcgcgagtacg
gactacgagaccgccgacaccggcggcgaggacgacgccttgctctattacacgtcgggg
acgaccgggttggcgaagggcgtccgccacaaacagcgatgggtggccggcgtggcggcg
acccagcggtacaccgtcgatctccagcccggtgacctctactggagtacgggcgatctg
ggctggctgaccggcgtgatcaacacgctcggggcctggttctggggtgcttcgctgttc
acctacgagggcgagttcgaccccgaaacatgggcggccctgctcgacgaatatccgatc
accgtgctgttctcggtgccgacggcctatcggatgctccgcgagaacgagtccgtcctc
gccgatgtcgacctcgagctgcgacacgcgctctcgatcggcgagccactcagcgccggc
gtcgtcgactggggggaggacgaactcggcgtcaccatcctcgacacctacggccagacg
gagacgggcaacatgatcatcaacaactacccgacgatggagctgcgacccggctcgatg
ggcaagccgctccctggcatcgaggccgacatcgtcgaccccgaaaccggtgccgtgctc
gagcccggtgaaacgggtgagatcgcccagcgcggggactatccctgcttcttcgacgaa
tactggcagaaaccggacaagaccgcgtcgtgtttcgtcgacggaccggacggggagtgg
tacctctcgggggatctcgcgcacaaggacgaggacggctacttctggttcgaggggcgt
gcggacgacgtcatcctgtcctcgggctaccggatcggcccgttcgaggtcgagagttcg
ctgggcgaacacgaggccgtcgccgaggcggccgtcgtgcctaaaccccacatggagcgg
ggcaacatcgtgaaggcctacgtcgtgccaagcgagggcacaacgccgtccgcggacctc
aaggaggacatcaggacccacgtgcgcgacgagctctcggcccacgagtacccccgggag
atcgagttccgcgaggaactgccgaagacggtcaccgggaagatccgtcgaaccgaactc
caagacgacgcggaagaagagaccgagacatcgacgtaa

DBGET integrated database retrieval system