KEGG   Natrinema sp. J7-2: NJ7G_2085Help
Entry
NJ7G_2085         CDS       T02184                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00330  Arginine and proline metabolism
nat00332  Carbapenem biosynthesis
nat01100  Metabolic pathways
nat01130  Biosynthesis of antibiotics
nat01230  Biosynthesis of amino acids
Module
nat_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NJ7G_2085
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NJ7G_2085
Enzymes [BR:nat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NJ7G_2085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AFO57326
UniProt: I7CX12
Position
complement(1825291..1826124)
Genome map
AA seq 277 aa AA seqDB search
MSKGLEEATVTEARRLAADADRVVVKAGTNSLTDDDSNLDDGKLDKLVDDIEDLLSRGKD
VILVSSGAIGAGTGRIEQSSGTVEESQALSTVGQSHLMHRYTESFDRYDRKVAQLLLTQH
DLENPERFTNLRNTVETLLDWGVVPIINENDAVATAEIRIGDNDMLSSAATMGVDADLLV
TLTDVGGVYTGNPKEDDDAERIEAVGTNYDEVQRIIGETTSDGFGGIQTKVEGARDVSEH
GIPAVIAKSTEPDVLERIATAKPVGTIFVPINGVNDD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagggactcgaggaggcgaccgtcacggaggcgcgacggctcgcggccgacgcc
gaccgcgtggtcgtcaaggccgggaccaattccctgaccgatgacgattcgaacctcgac
gacgggaaactcgacaaactcgtcgacgacatcgaggacctcctctcgcggggcaaggac
gtcatcctcgtctcgtcgggtgccatcggcgcggggacgggccggatcgagcagtcgagc
gggaccgtcgaggagtcccaggcgctctcgacggtcggccagagtcacctcatgcaccgc
tacaccgagagcttcgatcggtacgaccggaaagtggcccaactcctgctcacgcagcac
gacctcgagaaccccgaacggttcacgaacctccggaacaccgtcgagacgttgctggac
tggggcgtcgtcccgatcatcaacgagaacgacgccgtcgcgaccgcggagatccggatc
ggcgacaacgacatgctctcgtctgcggcgaccatgggcgtcgacgccgacctgcttgtc
acgctgaccgatgtcggcggcgtctacacgggcaacccgaaggaagacgacgacgccgag
cgcatcgaggcggtcggcaccaactacgacgaggtccagcggatcatcggcgagaccacg
tccgacggcttcggcggcatccagacgaaagtcgagggcgcacgcgatgtcagcgaacac
gggatcccggccgtcatcgcgaagtccacggagcccgacgtactcgaacggatcgctact
gcaaagcccgtggggaccatattcgtccccatcaacggggtgaacgatgactga

DBGET integrated database retrieval system