KEGG   Natrinema sp. J7-2: NJ7G_2180Help
Entry
NJ7G_2180         CDS       T02184                                 

Definition
Pyridoxal-5'-phosphate-dependent protein beta subunit
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nat01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nat00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:nat00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1894203..1895378
Genome map
AA seq 391 aa AA seqDB search
MSVSTEMAADLTCPDCGTVYEAGPDEPWRCGCGRALEFTERPHPQGDPLPLHSLDTSEGL
WTFFEFLPIEQHVTFYEGFTPTVEASDWDARFKLEYVFPTGSFKDRGATTTLSRAVELGV
EKVLEDSSGNAGASIATYAARAGVDADIYVPADVKQSKLMTIQRADARPVRIDGTRADVT
TACLEAVEGDANDGDSTGNEGSAPYQTGEGWYASHAWNPAFYAGTMTFAFEVAAQQGWTV
PDAVVLPLGHGTLFLGAYRGFSLLNEAGIVDGMPRLLGAQAAGYAPIVAALGGDTTDAEG
ERTDIADGIQITEPARGTEIVDAIEATDGDAIALGGDAIETALDRLHRNGFYVEPTCAIA
PAALEQYRDDGVIDADDDVVVPLTGSGLKTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgagtactgagatggccgccgatctaacctgtcccgactgcgggaccgtctac
gaggccggaccggacgaaccgtggcgctgtggctgtggccgcgccctggagtttaccgag
cggccgcatccgcagggcgatccgctgccgctgcacagcctcgataccagcgaggggctg
tggacgttcttcgagttcctcccgatcgaacagcacgtcaccttctacgagggctttacg
ccgacggtcgaggcctccgactgggacgcgcggttcaaactcgagtacgtcttcccgacg
ggctcgttcaaggaccgcggcgcgacgacgaccctctcacgggcggttgaactcggcgtc
gagaaggtgctcgaggattcctccggcaacgcgggcgcgtcgatcgcgacctacgcggcc
cgcgcgggcgtcgacgcggacatctacgtcccggcggacgtcaaacagtccaagctgatg
acgatccagcgggccgacgcccgcccggttcgcatcgacggaaccagagcggacgtgacc
acagcctgtctcgaggccgtcgaaggcgacgcgaacgacggcgattcgacgggcaatgag
ggcagcgccccgtatcagaccggcgagggctggtacgccagccacgcctggaaccccgcg
ttctacgccgggacgatgacgttcgcgttcgaggtggccgcccagcaggggtggacggtc
cccgacgccgtcgtcctcccgctcggccacggcacgctcttcctcggcgcgtatcggggc
ttttccctcctcaacgaggccggcatcgtcgacggcatgccgcgcctgctcggcgcacag
gcggccggttacgcgccgatcgtcgccgcgctcggcggcgataccaccgacgcggagggc
gaacggacggacatcgccgacggcatccagatcaccgaacccgcccgcggcaccgagatc
gtcgacgcgatcgaggcgaccgacggcgacgcgatcgccctcggcggggatgcgatcgaa
accgcgctggaccgactccaccgcaacggcttttacgtcgagccgacctgcgcgatcgcg
ccggcggccctcgagcagtaccgcgatgacggcgtcatcgacgccgacgacgatgtcgtc
gtgccgttgaccggcagcggactgaaaaccctctga

DBGET integrated database retrieval system