KEGG   Natrinema sp. J7-2: NJ7G_2413Help
Entry
NJ7G_2413         CDS       T02184                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_2413
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_2413
   00052 Galactose metabolism
    NJ7G_2413
   00500 Starch and sucrose metabolism
    NJ7G_2413
   00520 Amino sugar and nucleotide sugar metabolism
    NJ7G_2413
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NJ7G_2413
   00524 Butirosin and neomycin biosynthesis
    NJ7G_2413
Enzymes [BR:nat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NJ7G_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2084673..2085650)
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAIVAEADGTTIGVSRRSTPRGPTGIDVTEGVLRTLREACVDAGID
PERIAATGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPIAKLIDSNDVYLHNDTTAGV
IGERFHAVSNPDDMAYITISSGIGAGVCCDGAVMSGWDGNAGEVGHYVVDPQGRLTCGCG
RDGHWEAYCSGNAIPDYARLLAEDDPTISTALPVEGPDFTAKDVFELAGEDELADYVIEQ
LAHWNAIGVTNVVHAFAPIVVSFGGAVALHNEDLVVDPIRERVSEMVMTNVPEIRVTDHG
DDVVLEGALASALTEGTGDRRRLRG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtttactatgcgggcgtcgatctcggcgcgaccaacgtccgggccatcgttgccgag
gccgacgggacgacgatcggcgtgagtcgccgctccacgccacgcgggccgacgggtatc
gacgtgacggaaggtgtccttcgaacgctgcgcgaggcgtgtgtcgacgccgggatcgat
cccgagcgcatcgccgcgaccggtatcggctcgatcggtccgttcgacctcgcggagggt
gcggtgatcgatcccgccaacctccccgattccatcgaccggatcccgctgacgggaccg
atcgcgaaactgatcgacagcaacgacgtctatctccacaacgacaccaccgcgggcgtc
atcggcgaacgctttcacgccgtcagcaacccggacgacatggcctacatcaccatctcc
tcggggatcggtgccggcgtctgctgtgacggggccgtgatgagcggctgggacggcaac
gccggcgaggtcggccactacgtcgtcgacccgcagggtcgcctgacctgtggctgcggc
cgcgacggccactgggaggcctactgctccggcaacgccatccccgactacgcacggctg
ctcgccgaggacgatccgacgatatcgacggccctcccggtcgagggacctgacttcacg
gcgaaggacgtcttcgaactggccggcgaggacgaacttgccgattacgtcatcgagcaa
ctcgcccactggaacgccatcggcgtgaccaacgtcgtccacgccttcgccccgatcgtg
gtctccttcggcggcgcggtcgcactgcacaacgaggacctcgtcgtcgatcccatccgc
gagcgcgtctcggagatggtgatgacgaacgtccccgagatccgcgtcacggaccatggc
gacgatgtcgtcctcgaaggcgcgctggcgagtgctctgaccgagggcaccggggaccga
cggcggctgcggggctga

DBGET integrated database retrieval system