KEGG   Natrinema sp. J7-2: NJ7G_2451Help
Entry
NJ7G_2451         CDS       T02184                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nat  Natrinema sp. J7-2
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NJ7G_2451
Enzymes [BR:nat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NJ7G_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2116933..2119518)
Genome map
AA seq 861 aa AA seqDB search
MEYHEAADFLFDLRRFRPKPGTESTARLLAHLENPHETVDFVQIAGSNGKGSTARMLERT
LREAGYSVGLYTSPHLEDLRERVRVDGRKMSRAAVCDYVDAVREYITERGADGESPTFFE
TMTAMAIWQFGREDVDIAVLEVGIGGKYDATSVVDPVASAVTSVTLEHTGILGDTVAEIA
RDKAHVAPADAPLVTGVTGSPLESIRDVAGAVVTVGAATAADDGDDGTASDPDVRVAYGG
RTNHTEAAVSIDAETWDLETRIPLLGEHQAENAGIAATLVRQVGDVSAAEIARGLRSAHW
PGRFEVLDTEPLTVLDGAHNPGACEGLAETLDTYDYDDLYLVFGAMHDKDHREMAAALPT
PDTVVTTEPTLDRAEDRAVLADVFADAGVGTVRTETAVPDALATALGDAGSDDCVLVTGS
LFAVAEARSRWTRTDVPKRVRDRSDARDALAEANVAADDAERLDGDAVHRVVRTALRDRQ
ATVLKEELLRLGGECALSGLEHDDEPVDAVLMGTLAQFEALVEALETRTQPHGLTDVARE
LQDTLEVDAGPDASVADDTDADGDATEPIRAAGRPQTPGRPADGSTGPDYPWTDRTAVMG
ILNVTPDSFHDGGEYDALDDAVARAEEMVAAGADVIDIGGESTRPGAAPVSVEEELDRVV
PVVERIADLDALLSVDTRRAAVADAALEAGADIINDVSGLEDPEMRFVAADHDAGLVVMH
SIDAPVVPDRDVAYDDVVADVIDQLTERILLAEKAGLDREQIIVDPGIGFGKSAAENFEL
LDRIDEFHALGCPVLFGHSHKSMFGQVGREAGERLEATVAASALAADRGADLVRVHDVPE
NVAAVRTALAARDPERFDWES
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggagtatcacgaggcggcggatttcctcttcgatctgcgacggttccgcccgaagccg
ggcaccgagtcgaccgcccggctgttggcccacctcgagaacccacacgaaaccgtcgac
ttcgtccagatcgccggctcaaacgggaaagggagcacggcccgaatgctcgagcggacg
ctgcgggaggcgggctactccgtcggcctctacacctcgccacacctcgaggacctccgc
gagcgggtccgtgtcgacggccggaagatgtcgcgggcagccgtctgtgactacgtcgac
gccgtccgcgagtacatcaccgagcgcggtgccgacggcgagtccccgacgttcttcgag
acgatgaccgccatggcgatctggcagttcggccgcgaggatgtcgatatcgctgttctc
gaggtcggtatcggcggcaagtacgacgcgacgagcgtcgtcgatccggtcgccagcgcg
gtcacgagcgtgaccctcgagcacacgggcatcctcggcgacaccgtcgcggagatcgcc
cgcgacaaggcccacgtcgccccggccgacgcgccgcttgtcacgggcgtcacggggagt
ccgctcgagtcgatccgcgatgtcgccggcgcggtcgtcaccgtcggagcggcgacggcg
gccgacgacggcgacgacggcacggcttcggaccccgacgttcgggtcgcctacggcggg
cggacgaaccacaccgaagccgccgtttcgatcgatgccgagacgtgggatctcgagacg
cggattccgctgttgggggagcatcaggccgaaaacgccggtattgccgctaccctcgtc
agacaggtcggcgacgtttcggcggcggagatcgcgcgtggactgcgaagcgcccactgg
ccgggccggttcgaggtgctcgacacggagccgctgaccgtcctcgatggcgcgcacaac
ccgggtgcctgcgagggactcgccgagacgctcgacacctacgactacgacgacctctac
ctcgtcttcggcgcgatgcacgacaaggaccaccgcgagatggccgccgccttgccgacg
cccgacaccgtcgtgacgaccgaaccgactctcgaccgggccgaggatcgggccgtcctc
gccgatgtcttcgccgatgccggcgtcgggaccgtccgtaccgagaccgcggtcccggac
gcgctcgcgaccgccctcggcgacgccgggagtgacgattgcgtgctcgtcaccggctcg
ctgttcgcggtcgcggaggcccgatcgagatggacccgtaccgacgttccgaagcgtgtc
cgcgaccgctccgacgcccgtgacgcgctcgcggaggcgaacgtcgccgcggacgatgcc
gagcgactggacggcgacgctgtccatcgagtcgtcaggacggcgcttcgggaccgacag
gcgaccgtcctcaaggaggaactgctgcggttgggtggtgaatgcgcactctcgggcctc
gagcacgacgatgaacccgtcgacgccgtgttgatgggcacgctcgcccaattcgaagcg
ctcgtcgaggctctcgagacgcgcacacaaccccacggcctgaccgacgtcgcccgcgag
ttacaggacacgctcgaggtcgacgccgggcccgatgccagcgtcgccgacgacacggat
gccgacggcgacgcgacggaaccgattcgggccgccggccgaccgcagacgcccggtcgg
ccggccgacggctcgaccggcccggactacccctggaccgatcggacggccgtgatgggg
attctgaacgtcacgcccgacagcttccacgacggcggcgagtacgacgccctcgacgac
gccgtggcccgcgccgaggagatggtcgcggccggcgctgacgtgatcgatatcggcggg
gagtcgacccggccgggcgctgctcccgtgtcggtcgaggaggaactcgaccgggtcgtg
ccggtcgtcgaacggatcgccgacctcgacgccctgctctcggtcgacacccgcagagcc
gccgtcgccgacgccgcgctcgaggccggtgccgacatcatcaacgacgtgtcggggctc
gaggaccccgagatgcgattcgtcgccgccgaccacgacgcggggctggtcgtgatgcac
agcatcgacgcgccggtcgtccccgatcgcgatgtcgcgtacgacgatgtcgtcgcggac
gtgatcgatcaactcaccgaacgcattttgctggccgagaaggcggggctggaccgcgag
cagatcatcgtcgatcccggcatcggtttcggcaagtccgccgccgagaacttcgaactg
ctcgaccggatcgacgagttccacgcgctcggctgtcccgtcctcttcgggcactcccac
aagtccatgttcggccaggtcggccgcgaggccggcgaacgactcgaggcgaccgtcgcg
gccagcgccctcgcggccgaccgcggagccgacctcgtacgcgtccacgacgtgcccgag
aacgtcgccgcggttcggacggcgctcgccgcgcgtgacccggagcgcttcgactgggag
tcgtaa

DBGET integrated database retrieval system