KEGG   Natrinema sp. J7-2: NJ7G_2613Help
Entry
NJ7G_2613         CDS       T02184                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nat  Natrinema sp. J7-2
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NJ7G_2613
Enzymes [BR:nat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NJ7G_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2257498..2258385)
Genome map
AA seq 295 aa AA seqDB search
MFPGATDEREGTDAAAQSDRDGDTDTGGHASTRGGANFVVVGAPLDATTTFQPGTRFGPR
RIRSFAEPFDDYDHRTDRYFSELGVVDRGDVRAWDDVEAYLDYLTSTLREAVWNDAVPLL
LGGEHTVSLAGVRAVEPEVFVCLDAHLDLYDAYDGNPLSHAAVTRRILEDVDSIAEAIVL
GARTGSEAEWERAADDDVTVVPPEEVSEWTPGDRFVDREVYLSVDIDAADPGYAPGTGTK
EPFGLEPRELRDVVRAVAPQASGFDVVEVNDRDDGQAAALAGKLVREFVFSNADG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccggggcgaccgacgaacgcgaggggaccgacgcggcggcacagtccgatcgt
gacggcgacaccgacacgggagggcacgcgtccacccgtggcggcgcgaacttcgtggtc
gtcggtgcgcccctggacgctacgacgacctttcagccggggacccgctttggaccccga
cgcatccgatcgtttgccgaaccgttcgacgactacgaccaccggacggaccgatacttt
tcagaacttggcgtcgtcgaccgcggcgacgttcgggcctgggacgacgtcgaagcgtat
ctcgactatctgacgagtacgctccgcgaggccgtctggaacgacgccgtacccctgctg
ttggggggcgaacacaccgtttcgctcgcgggtgtccgcgcggtcgaacccgaggtgttc
gtctgtctcgacgcccacctcgacctgtacgacgcctacgacgggaacccgctctcgcat
gccgccgtcacccgccggattctcgaggacgtcgactccatcgccgaggcgatcgtcctc
ggtgctcgaaccggcagcgaagccgagtgggagcgggcggccgacgacgacgtgaccgtc
gtcccgcccgaggaggtgagcgagtggacgcccggcgaccgatttgtggaccgcgaggtc
tacctgagcgtcgacatcgacgccgccgaccccggctacgcgccgggaaccggcaccaaa
gagccgttcggcctcgagccccgcgaacttcgcgacgtggtacgcgcggtcgcaccgcag
gccagcgggttcgacgtggtcgaagtcaacgaccgcgacgacgggcaggcggccgcgctg
gctggaaagctggtccgggagttcgtcttttcgaacgccgacgggtga

DBGET integrated database retrieval system