KEGG   Natrinema sp. J7-2: NJ7G_2616Help
Entry
NJ7G_2616         CDS       T02184                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nat  Natrinema sp. J7-2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NJ7G_2616
Enzymes [BR:nat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NJ7G_2616
Peptidases [BR:nat01002]
 Cysteine Peptidases
  Family C44
   NJ7G_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2260248..2261921)
Genome map
AA seq 557 aa AA seqDB search
MATVLLANPNAEVVTRDERRWIIAGTHRRELRTAIERGAPFAAVKALHDSLPGEGTIVVL
SERAAEPTVQAHRGITSAYEVFYCRDSSGEPVVTDLFRNALARLEPADRTVPERAKADHL
LYRTTPIDSYVERIHRLGHGETLTWTPGETTPRTELTETLTPESGLAPASAHERLDEVLS
AVCAPVADEAALMLSGGVDSTVLEPYLTTPTESVTASFDTPELAFERTYADRASDLIETD
REVVEMAESNYLERLEAAVDALGLPPHQLQTPTFDGIYREYDGPDTLVSGQVADAVFGLG
GSLETARTVWRTRYLGYVPPVVEKLRHHRDVLEGLRRHPSDPDGQGLQFAVYTDVPAVVE
AIGRRQYERRQRERYRYAMNRVPAASGTRYARHVHVGQWVDFFCEDAVTVWRQAALARGR
EMYTPFAGKAVAELALGLPSPERYVRNGEPKHLPKRLLGEWYPAYDRRKPKGNGNFPAER
FLGSGPLESIFDRYDVPEFAPDISGAIVDRSPGLAWNLAGYAVWRDRVLRAADLEPVAHT
RTVSVPSKTPRSEGEPV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtgttgctcgcgaatccgaacgccgaggtcgttacccgagacgagcgccgg
tggatcatcgccgggacacaccggcgcgaactccgcacggcgatcgaacgcggcgccccg
ttcgcggcggtcaaagcgcttcacgactccctgcccggcgagggaacgatcgtcgtcctc
tcggagcgggcggccgaaccgacagtgcaggcccaccgcgggatcacgtcggcctacgaa
gtgttctactgccgcgactcgagcggcgagccggtcgtcaccgacctgtttcgaaacgcc
ctcgcccgccttgagccggcggatcgaacggtcccggagcgggcgaaagctgaccacctg
ctctaccggacgacaccgatcgactcctacgtcgagcggattcatcggctcggtcacggc
gagacgctcacctggacgcccggcgagacgacgccccgaaccgagctgacggagacgctc
acgcccgagtcggggcttgcgccagcgagcgcacacgagcggctcgacgaggtcctgtcg
gcggtctgtgcccccgtcgcggacgaggcggcgctcatgctctcgggcggcgtcgattcg
accgtcctcgagccctatctgacgaccccaaccgagagcgtgacagcgtcgttcgacacg
cccgaactggcgttcgaacgcacgtacgccgaccgcgcgagcgacctcatcgagaccgac
cgcgaggtcgtcgagatggccgaatcgaactacctcgagcggctcgaggcggccgtcgat
gcgctggggctgccgccccatcaactccagacgccgacgttcgacggcatctaccgcgag
tacgacggacccgacacgttggtcagcggtcaggtcgcggacgccgtcttcggcctcggc
ggctcgctcgagaccgctcgcacggtctggcggacgcgctacctcggctacgtcccgccg
gtcgttgagaaactccggcatcatcgggacgtactcgagggactccggcggcatccgtcc
gatcccgacggacaggggctgcagttcgcggtctacacggatgtcccggcggtcgtcgag
gcgatcggacgccggcagtacgagcgacgccagcgcgagcgctacaggtacgcgatgaat
cgggtgcctgcggcgtcagggaccaggtacgcccgacacgtccacgtcggacagtgggtc
gacttcttctgcgaggacgccgtcaccgtctggcggcaagccgccctcgcccgcggccgc
gagatgtacacgccgttcgcgggcaaggccgtcgccgaactcgcgctcggactcccctcg
cccgagcggtacgtccgcaacggcgagcccaaacacctcccgaagcgactgctcggcgag
tggtaccccgcgtacgaccggcgcaagcccaaggggaacgggaacttccccgcggagcga
tttctcggatcggggccgctcgagtcgatcttcgaccgctacgacgtccccgagttcgcc
ccggacatctcgggcgcgatcgtcgaccgctcccccggcctcgcgtggaacctggcgggc
tacgccgtctggcgcgaccgcgtcctccgcgcggccgacctcgagccggtcgcccacacc
cggaccgtgtcggtaccatcgaagacgccccgctccgagggggagccggtgtga

DBGET integrated database retrieval system