KEGG   Natrinema sp. J7-2: NJ7G_2704Help
Entry
NJ7G_2704         CDS       T02184                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nat  Natrinema sp. J7-2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NJ7G_2704
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NJ7G_2704
Enzymes [BR:nat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NJ7G_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2335560..2337137
Genome map
AA seq 525 aa AA seqDB search
MLTADGRELTLATKVGQLFVVGFDGTAPTDDLRTLITDRQCGNVVYFSRNIETPDQVATL
TDRLRRLILEETGTPPFVMADQEGGVVSRLGWGTALPSQMCLGASADPDLARAGGEAVAA
ELAALGINVNLAPVLDVNNNPRNPVIGVRSFGEDPDLVGDLGAELAMGMQSNGVIACGKH
FPGHGDTSTDSHHELPVVEHDRERLEAVEFAPFRRAIDAGIDAIMTTHVSFPAIADSPST
PATVSPAVQRRLLRDELGFDGLIVTDGMEMRALAETVGTAEGCVRALEAGCDLLLVCHTP
ETQADAIDAVIDAVESGRLDEATIDAAVERILRFKRRRLSASSPPSAARWEETADRSHEV
GRTIAARGITLVRDRDDTLPLTTERPLQLVGSSGGRTSPAEDDDFEPTLLADSLAAAGFD
VTCHEVADRTELPSFDAGTQVIATVDGAMADDSRAAVVRTLDDRRRRFAAVVVRNPYDLS
AVPDVSTAVSTYDYTRATRTALCEVLLGEATATGRLPVTVPEFAD
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagcagacggacgcgagttgactctcgcgacgaaagtcggccaactgttcgtc
gtcgggttcgacgggacggccccgaccgacgaccttcgaacgttgatcaccgaccgacag
tgtggcaacgtcgtctacttcagtcggaatatcgagacccccgaccaggtcgcgacgcta
accgaccgcctacggcgactgatactcgaagagactgggaccccgccgttcgtgatggcc
gaccaggaaggcggggtggtctctcgcctcggctgggggacggcactgccgagtcagatg
tgtctcggtgcaagcgccgaccccgacctcgcgcgtgccggcggcgaggccgtcgccgcc
gaactggcagccctcggtatcaacgtcaatctggctccggtactcgacgtcaacaacaac
ccacggaatccggtgatcggcgtccgctcgttcggcgaggaccccgacctggtgggcgac
ctcggggccgaactggcgatggggatgcaatccaacggggtcatcgcctgcgggaaacac
ttcccgggccacggcgacacgagtaccgactcccatcacgaactgccggtcgtcgaacac
gaccgcgagcgactcgaggccgtggaattcgcgccgttccggcgcgcgatcgatgccggt
atcgacgcgattatgacgacacacgtgtcgttcccggctatcgcggactccccgtcgacc
ccggcgacggtgtcgcctgccgtccaacggcgactgctccgcgacgaactcggcttcgac
ggactcatcgtgaccgacgggatggaaatgcgtgctctcgcggagacggtcggcacggcg
gaaggctgcgtccgggcgctcgaggcgggctgtgatctactgctcgtctgtcacacgccc
gaaacgcaggcggatgcgatcgacgccgtgatcgacgcggtcgaatcgggtcggctcgac
gaagcgacgatcgacgcggccgtcgagcggattcttcggttcaaacgccgccggctgagc
gcctcgagtccgccgtcagccgcgcgctgggaggagacggccgaccggtcccacgaggtc
ggcaggacgatcgccgcccgcgggatcacgctcgtccgggaccgagacgacacgctcccg
ttgacgaccgagcggccgcttcagctggtcgggtcgtcggggggtcggacgtcgccggcg
gaggacgacgacttcgagccgacgctgctcgccgactcgctcgcggccgccgggttcgat
gtcacctgccacgaggtcgccgaccggaccgagctgccgtcgttcgacgctgggacacag
gtgatcgccaccgtcgacggcgcgatggccgacgactcgcgggcggccgtggtccggacg
ctcgacgaccgcagacgacggttcgcggcggtcgtcgttcgcaacccctacgacctgtcg
gcagttcccgatgtctcgaccgcggtgtcgacgtacgattatacgcgggcgacgcgcact
gcgctctgcgaggtcctgctcggcgaggcgacggcgaccggtcggctgccggtcaccgtc
cccgaattcgcggactga

DBGET integrated database retrieval system