KEGG   Natrinema sp. J7-2: NJ7G_2939Help
Entry
NJ7G_2939         CDS       T02184                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nat  Natrinema sp. J7-2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nat01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nat00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2548962..2550260
Genome map
AA seq 432 aa AA seqDB search
MTIDVQTVADLGPDDRAAFFDRDAGIESVRGDVREIVERVRTEGDVAVREYTSDFDDVEV
GNLEITDDCERAYDEIDDGMRDAIERAAANVREFHEAQCPEDWRREFSEGRTLGRRFRPI
ERVGVYVPGGSAAYPSSAIMGVVPAVVAGVDHVSVVTPPADELNPVTLAAIHAAGADAVY
CVGGAQAIAGMAYGTETITRVQKIVGPGNKWVTAAKAEVRGDVEIDFLAGPSEVVVVADE
SADPELVAAELVAQAEHDPNASVVAVTDDAETADAVAAAVDEQADAREREAVIREALGND
ASGVLRARSMSEAILFAEEYAPEHLSIIAEDDDSLLERIDSAGSVFLGPNTPVAAGDYAS
GTNHVLPTNGGARVTGGLAVETFLRSTTVQRLSEKGLADMGETITTLATAEGLEAHAESV
RSRLEDEPDTDE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgacgtgcagacggtcgccgatctcgggccggacgaccgcgcggccttcttc
gatcgcgacgccggtatcgagtcggtcaggggagacgttcgggagatcgtcgaacgcgtt
cgcacggagggtgacgtcgcggtccgcgagtacaccagcgacttcgacgacgtcgaagtc
ggcaacctcgagatcaccgacgactgcgagcgcgcgtacgacgagatcgacgacgggatg
cgggacgcgatcgagcgggccgcggcgaacgtccgcgagttccacgaggcccaatgtccc
gaagattggcggcgggagttcagcgaggggcgcacgctaggccggcgtttccgaccgata
gagcgtgtcggcgtctacgtccccggcggctcggcggcctacccctcgagcgcgatcatg
ggtgtcgtgccggcggtcgttgccggcgtcgatcacgtgtccgtggtcacgccgccggcg
gacgaactgaacccggtgacgttggcggcgatccacgcggcgggcgcggacgcggtctac
tgcgtcggcggcgcgcaggcgatcgcgggaatggcctacgggacggaaacgatcacccgc
gtccagaagatcgtcgggcccggaaacaagtgggtgaccgcggccaaggccgaggtacgg
ggtgacgtcgagatcgacttcctcgccggacccagcgaagtggtcgtcgtggccgacgag
agcgcggacccggaactcgtcgccgcggaactcgtcgcacaggccgagcacgatcccaac
gcctcggtcgtggctgtcaccgacgacgccgagaccgccgacgcggtggccgcagccgtc
gacgagcaggccgacgcgcgcgaacgagaggccgtaattcgagaggcgctcggaaacgat
gcgagcggcgtcctccgtgcgcgatcgatgagcgaagcgatcctcttcgccgaggagtac
gcgcctgaacacctctcgatcatcgccgaggacgacgactcgctcctcgagcgcatcgac
agcgccggcagcgtctttctcggtccgaacacccccgtcgcggcgggtgactacgccagc
ggtaccaatcacgtcctgccgaccaacggcggcgcgcgcgtgactggcgggctcgcggtc
gagacgttcctgcgatcgacgacggtccagcgactctcggagaagggcctcgccgacatg
ggcgagacgatcaccacgctcgcgacggccgagggactcgaggcccacgccgagagcgtc
cggagtcgactcgaggacgagccggacaccgacgaatag

DBGET integrated database retrieval system