KEGG   Natrinema sp. J7-2: NJ7G_3002Help
Entry
NJ7G_3002         CDS       T02184                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nat  Natrinema sp. J7-2
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NJ7G_3002
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    NJ7G_3002
Enzymes [BR:nat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     NJ7G_3002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2603149..2604015)
Genome map
AA seq 288 aa AA seqDB search
MTVDEALAKYGPSELARDDLLELEDPHYTAENVAIVTGAGSGIGRATALAFAANELTVVA
TDRDEDGLTETQTQSEELALPGDLVTVVADLTTDSDLERIVDEAADHGSIRYLANIAGIQ
TVAPIESFPLEKYDLMHDVMQRAPMVLTKHCLPHFRDNEDGVGVVGNMCSVHGHIVTQDK
VAYNTTKFGLRGLTQSIAAEGDGTVRAFTVSTAYVKTALVAKQLPETADRRDMTVDEVVE
NVMLEHTRVTEMMEPYEVANLFVMGCSQHSKHLNGGDMTHDGGMSLTY
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgacgaggccctggcgaagtacggcccgtccgaactcgctcgcgacgacctg
ctggaactcgaggacccacactacaccgccgagaacgtcgcgatcgtaacgggtgcgggt
tcggggatcggccgagcaactgcgctggccttcgccgcgaacgaactgaccgtcgtcgca
accgaccgcgacgaggacgggctcaccgaaacgcaaacgcagtccgaggagttggccctg
ccgggcgacctcgtgacggtcgtcgccgacctgaccaccgattcggacctcgagcgcatc
gtcgacgaagcggccgaccacggcagtattcgatatctggccaacatcgccggaattcag
acggtcgcgccgatcgagtcgttcccgctcgagaagtacgatctgatgcacgacgtcatg
cagcgggctccgatggtcctcaccaaacactgtctccctcatttccgcgacaacgaggac
ggcgtgggagtcgtcgggaacatgtgttcggtccacggccacatcgtcacccaggacaag
gtcgcgtacaacacgacgaagttcggattacgcggactcacgcagtcgatcgccgccgaa
ggcgacgggaccgtccgggcgttcaccgtcagcactgcctacgtcaagacggcgctcgtc
gcgaaacaactccccgagacggccgaccgccgcgatatgaccgtcgacgaagtcgtcgag
aacgtcatgctagaacacacccgcgtcacggagatgatggaaccctacgaggtcgcgaac
ctgttcgtgatgggctgttcacagcacagcaagcacctcaacggcggggatatgactcac
gacggcgggatgagcctgacgtactga

DBGET integrated database retrieval system