KEGG   Natrinema sp. J7-2: NJ7G_3429Help
Entry
NJ7G_3429         CDS       T02184                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nat  Natrinema sp. J7-2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nat00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:nat00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2959589..2960146
Genome map
AA seq 185 aa AA seqDB search
MSDTRDETPAATLAFETDRELVGIVAVADNGVIGRDGDMPWHIPADLQHFKETTMDHPVI
MGRETYEGILETLGEPLPGRTTVVLTSRELETPDNAVVANGLEEAVDRADTAARERHGDA
DRLFIAGGATVYEAFLPALDRLIVTEVHDEPDGDTFFPDWERESWTEASRDDRDGFAFVE
YVRER
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacgcgggacgagacgccggccgcgaccctggctttcgagaccgaccgcgaa
ctcgtcggtatcgtcgccgtcgcggacaacggcgtcatcggacgggacggcgacatgccc
tggcacatcccggccgacctccagcacttcaaggagacgacgatggaccaccccgtcatc
atgggccgggagacctacgagggaatcctcgagacgctgggggagccactgcccgggcga
acgaccgtcgtgttgacgagtcgggagctcgagacacccgataacgccgtggtcgcgaac
ggactcgaggaagccgtcgaccgggccgacacggccgcacgggagcgccacggcgacgcc
gatcggctcttcattgccggcggggcgaccgtctatgaggcgtttctccccgcgctcgat
cggctgatcgtaaccgaagtccatgacgaaccggacggcgacacgttcttccccgattgg
gagcgggagtcgtggacggaggcgtctcgagacgaccgcgacgggttcgcgttcgtggag
tacgtccgcgagcggtaa

DBGET integrated database retrieval system