KEGG   Natrinema sp. J7-2: NJ7G_3429Help
Entry
NJ7G_3429         CDS       T02184                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nat  Natrinema sp. J7-2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NJ7G_3429
   00670 One carbon pool by folate
    NJ7G_3429
Enzymes [BR:nat01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NJ7G_3429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2959589..2960146
Genome map
AA seq 185 aa AA seqDB search
MSDTRDETPAATLAFETDRELVGIVAVADNGVIGRDGDMPWHIPADLQHFKETTMDHPVI
MGRETYEGILETLGEPLPGRTTVVLTSRELETPDNAVVANGLEEAVDRADTAARERHGDA
DRLFIAGGATVYEAFLPALDRLIVTEVHDEPDGDTFFPDWERESWTEASRDDRDGFAFVE
YVRER
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacgcgggacgagacgccggccgcgaccctggctttcgagaccgaccgcgaa
ctcgtcggtatcgtcgccgtcgcggacaacggcgtcatcggacgggacggcgacatgccc
tggcacatcccggccgacctccagcacttcaaggagacgacgatggaccaccccgtcatc
atgggccgggagacctacgagggaatcctcgagacgctgggggagccactgcccgggcga
acgaccgtcgtgttgacgagtcgggagctcgagacacccgataacgccgtggtcgcgaac
ggactcgaggaagccgtcgaccgggccgacacggccgcacgggagcgccacggcgacgcc
gatcggctcttcattgccggcggggcgaccgtctatgaggcgtttctccccgcgctcgat
cggctgatcgtaaccgaagtccatgacgaaccggacggcgacacgttcttccccgattgg
gagcgggagtcgtggacggaggcgtctcgagacgaccgcgacgggttcgcgttcgtggag
tacgtccgcgagcggtaa

DBGET integrated database retrieval system