KEGG   Natrinema sp. J7-2: NJ7G_3505Help
Entry
NJ7G_3505         CDS       T02184                                 

Definition
succinate dehydrogenase, subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nat  Natrinema sp. J7-2
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_3505
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NJ7G_3505
   00650 Butanoate metabolism
    NJ7G_3505
  Energy metabolism
   00190 Oxidative phosphorylation
    NJ7G_3505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3032857..3033222
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTPGGTGWFLQRITAAFLVVVLAFHFFLLHFVNHAYEVTFMGTQTRMQNVGYF
LTMVLFLITAAFHGVNGVYNALVNQGLEGGRKKAVLAVLTLASVALVAQGIYVALAMRGM
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgatactcctcgtttacccccggcggcaccggctggttcctccagcggatc
acggcggcgtttctcgtcgtcgttcttgccttccatttcttcctcctgcacttcgtcaac
cacgcgtacgaggtaaccttcatggggacccagacccgaatgcagaacgtcggatacttc
ctgacgatggtcctgttcctgatcaccgccgcgttccacggcgtcaacggcgtctacaac
gccctcgtcaatcagggactcgaggggggacggaagaaggccgtgctggcagtactgacc
ctcgccagcgtcgcactcgtcgcacagggtatctacgtcgcgctcgcgatgcgaggaatg
atctaa

DBGET integrated database retrieval system