KEGG   Natrinema sp. J7-2: NJ7G_3505Help
Entry
NJ7G_3505         CDS       T02184                                 

Definition
succinate dehydrogenase, subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nat  Natrinema sp. J7-2
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_3505
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NJ7G_3505
   00650 Butanoate metabolism
    NJ7G_3505
  Energy metabolism
   00190 Oxidative phosphorylation
    NJ7G_3505
   00720 Carbon fixation pathways in prokaryotes
    NJ7G_3505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3032857..3033222
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTPGGTGWFLQRITAAFLVVVLAFHFFLLHFVNHAYEVTFMGTQTRMQNVGYF
LTMVLFLITAAFHGVNGVYNALVNQGLEGGRKKAVLAVLTLASVALVAQGIYVALAMRGM
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgatactcctcgtttacccccggcggcaccggctggttcctccagcggatc
acggcggcgtttctcgtcgtcgttcttgccttccatttcttcctcctgcacttcgtcaac
cacgcgtacgaggtaaccttcatggggacccagacccgaatgcagaacgtcggatacttc
ctgacgatggtcctgttcctgatcaccgccgcgttccacggcgtcaacggcgtctacaac
gccctcgtcaatcagggactcgaggggggacggaagaaggccgtgctggcagtactgacc
ctcgccagcgtcgcactcgtcgcacagggtatctacgtcgcgctcgcgatgcgaggaatg
atctaa

DBGET integrated database retrieval system