KEGG   Natrinema sp. J7-2: NJ7G_3505Help
Entry
NJ7G_3505         CDS       T02184                                 

Definition
(GenBank) succinate dehydrogenase, subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nat  Natrinema sp. J7-2
Pathway
nat00020  Citrate cycle (TCA cycle)
nat00190  Oxidative phosphorylation
nat00650  Butanoate metabolism
nat00720  Carbon fixation pathways in prokaryotes
nat01100  Metabolic pathways
nat01110  Biosynthesis of secondary metabolites
nat01120  Microbial metabolism in diverse environments
nat01130  Biosynthesis of antibiotics
nat01200  Carbon metabolism
Module
nat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nat_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NJ7G_3505
   00650 Butanoate metabolism
    NJ7G_3505
  Energy metabolism
   00190 Oxidative phosphorylation
    NJ7G_3505
   00720 Carbon fixation pathways in prokaryotes
    NJ7G_3505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CCB2_CCB4
Motif
Other DBs
NCBI-ProteinID: AFO58723
UniProt: I7CWY3
Position
3032857..3033222
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTPGGTGWFLQRITAAFLVVVLAFHFFLLHFVNHAYEVTFMGTQTRMQNVGYF
LTMVLFLITAAFHGVNGVYNALVNQGLEGGRKKAVLAVLTLASVALVAQGIYVALAMRGM
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgatactcctcgtttacccccggcggcaccggctggttcctccagcggatc
acggcggcgtttctcgtcgtcgttcttgccttccatttcttcctcctgcacttcgtcaac
cacgcgtacgaggtaaccttcatggggacccagacccgaatgcagaacgtcggatacttc
ctgacgatggtcctgttcctgatcaccgccgcgttccacggcgtcaacggcgtctacaac
gccctcgtcaatcagggactcgaggggggacggaagaaggccgtgctggcagtactgacc
ctcgccagcgtcgcactcgtcgcacagggtatctacgtcgcgctcgcgatgcgaggaatg
atctaa

DBGET integrated database retrieval system