KEGG   Natrinema sp. J7-2: NJ7G_3529Help
Entry
NJ7G_3529         CDS       T02184                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
nat  Natrinema sp. J7-2
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nat00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NJ7G_3529
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    NJ7G_3529
Enzymes [BR:nat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     NJ7G_3529
Two-component system [BR:nat02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   NJ7G_3529
Bacterial motility proteins [BR:nat02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NJ7G_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3060541..3061758)
Genome map
AA seq 405 aa AA seqDB search
MTRVLVVDDSRFMRTVIGNALEAAGYDIETASNGSEAVETVATFEPDVVTMDVEMPEMGG
IDAVERIMATNPTPILMLSVHTERGAEATLDALERGAVDFLHKPDGSDSRNIAHLSDDVV
DAVGELAEADVSSVALARASAAAYATRSERADSAGRGTTTGNAVAGGGAETRPNPDSGTI
DPEAGPEIGAPIDPDEDAAPVAVDGDRADAPTIVLGASTGGPKIVERLFERLPADLEAKV
LVVQHMPPGFTERFADRLDANSAYDVSEAADRDWVRAGEVAVAPGNHHLEVARNVNGALR
LRLDDGTRVHGVRPSIDVTMKSAADRVSDALCGIVLTGMGRDGAAGIEAIKAAGGRTIAQ
DEATSPVFGIPCQAIETGCVDTIAPANGIAEAIVDAFTTDGENDE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtactcgttgtcgacgactcgaggtttatgcggacagtcatcggcaacgcg
ctcgaggcggccggttacgatatcgaaacggcgtcgaacggctccgaggccgtcgagacc
gtcgccacgttcgagccggacgtcgtgacgatggacgtcgagatgcccgagatgggcggt
atcgacgccgtcgagcgaatcatggcgacgaacccgaccccgatcctcatgctcagcgtg
cacaccgaacgcggcgctgaggcgacgctcgatgccttggagcggggtgccgtggacttc
cttcacaagcccgacggctccgactcgcggaacatcgcccacctcagcgacgatgtcgtc
gacgcggtcggcgaactcgccgaggccgacgtctcgtcggtagcactcgcgcgagcctcg
gcggcagcctacgcgactcgctcggaacgcgccgacagtgcagggcggggaacgacgacc
ggcaacgcggtcgccggcggcggggcggagactcgaccgaaccccgactccgggacgatc
gatcccgaggcgggaccggagatcggcgcacctatcgatccggacgaggacgcggctccg
gtcgccgtcgacggcgaccgcgccgatgcaccgacgatcgtcctcggcgcgtcgaccggc
gggccgaagatcgtcgaacggctgttcgaacgactcccggccgatctcgaggcgaaagtg
ctggtcgtccagcacatgccacccggattcaccgagcggttcgccgaccgactcgacgcg
aacagcgcgtacgatgtcagcgaggcggcggatcgagactgggtccgcgccggcgaggtt
gcggttgcgccgggcaaccaccatctcgaggtagcacgcaacgtcaacggtgcccttcgc
ctgcgactcgacgacggcacgcgcgtccacggcgtgcgaccgtcgatcgacgtgacgatg
aagagcgccgccgaccgggtctccgatgcgctctgtggcatcgtcctgaccggaatgggc
cgtgacggggcggccgggatcgaggcgatcaaggccgccggcggtcggaccatcgcacag
gacgaggcgacgagtccggtctttggcatcccctgtcaggcaatcgaaacgggctgtgtc
gatacgatcgcgcccgcaaacggcatcgccgaggcgatcgtcgacgcgttcacgacggac
ggtgagaacgatgagtga

DBGET integrated database retrieval system