KEGG   Natrinema sp. J7-2: NJ7G_3582Help
Entry
NJ7G_3582         CDS       T02184                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00860  Porphyrin and chlorophyll metabolism
nat01100  Metabolic pathways
nat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NJ7G_3582
Enzymes [BR:nat01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     NJ7G_3582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 MCM Sigma54_activat VWA_3 AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: AFO58799
UniProt: I7CLV9
Position
3109890..3112118
Genome map
AA seq 742 aa AA seqDB search
MVVNAGGKKLSSLPFPAIVGQNELKRVLLAVAANDGLDGALIVGEKGTAKSTAVRALVDL
LPDQRAVADCPYGCSPDDPDLQCEDCRERDPADLPVETRPVPLVTLPLGATRDRVVGTLS
VEDALAGEADFDPGLLARAHRGILYVDEVNLLDDHLVDVILDAAASGVNTVERDGISVSH
PADFTLIGTMNPEEGDLRPQLRDRFALQASVEGCREIDDRVEIIDRALEADGGASDPRPD
YADAVDALREDLAAARDRLSSVDLPTDFKAEIAELCLEAGVDGHRGDVATARTAMTLAAL
EGRETVIEPDIHEAATYALPHRLRSTPFEDEPDLDDLLEDRFDEESPDETEGEEGGDADD
GDSAKETDGEDGDADSDSGDGDDRGDRDEGNGNDGDDGADGEDSSDGAGSGGDEDSTDTD
DGPERRPDGDRPESAAQSSAEAGDGGSDDGSSDGESDSETSPDDEDEETAQPLVPGQQRA
GVGKARAPDLESPTVDSETPSATGTRASTSPSTANRGARVRTEPASGEGSIDAAASVRSA
AARGASRVGEDDFRQSVRTGDTSVTIVFAVDASASMRPAMRTAKGVVLELLRDSYEHRDQ
VSFVAFAGEDADVLLPPTDSVSLAARHLKDLPSGDRTPLPAGLETSRRVLERAETDASVV
VLVTDGRANVADGSPTAATRTAARALATSDARVIVVDAGEDSRAGLSELVATETDGELVD
LASLSVETVRAAAETAADETRG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaaacgccgggggcaaaaagctgtcgtcactcccgtttccggcgatcgtcgga
cagaacgagctaaagcgcgtgttgctcgccgtcgcggccaacgacggtctcgacggggcc
ttgatcgtcggcgagaaagggaccgcgaagtcgacggcagttcgggcgctcgtcgatctc
ctgcccgaccagcgggccgtggcggactgtccgtacggctgttcacccgacgaccccgac
ctgcaatgcgaggactgccgtgaacgcgatccagcggacctgccggtcgaaacgcgaccc
gttccgctcgtgacccttccgctgggcgcgacgcgggaccgcgtcgtcgggaccctctcg
gtcgaggacgcgctggccggcgaagccgacttcgatccagggctgttggcccgtgcccac
cggggcatcctctacgtcgacgaggtcaacctgcttgacgatcacctcgtggacgtcatc
ctcgacgccgccgcaagcggcgtcaacacagtcgagcgcgacgggatcagcgtctcccac
cccgccgatttcaccctgatcggcacgatgaacccggaggagggcgacctgcgcccacaa
ctgcgggaccgctttgccctccaggccagcgtcgagggctgccgggagatcgacgatcgg
gtcgagatcatcgatcgcgcgctcgaggccgacggcggcgcgtccgatccgcgacccgac
tacgccgacgcggtcgatgccctgcgcgaggacctcgccgcggcccgggatcgcctctcg
agcgtcgacctccccaccgacttcaaggccgagatcgccgaactctgtctcgaggccggc
gtcgacggtcaccgcggcgacgtggcgacggcccgcaccgcgatgacgctggccgcgctc
gagggccgtgagacggtcatcgagcccgacatccacgaggccgcgacctacgccctcccc
caccgcctccggagcaccccattcgaggacgaacccgacctcgacgacctgctcgaggat
cggttcgacgaggagtcgccggacgagaccgagggggaagaggggggtgacgcggacgac
ggtgacagcgcgaaggaaacggacggcgaggacggcgacgccgactccgactcgggcgac
ggtgacgaccgcggtgatcgcgacgagggaaacgggaacgacggggacgacggtgctgac
ggtgaagattcgagcgacggagcggggtccggcggcgacgaggacagcaccgacactgac
gatggtcccgagcgccgccccgacggcgaccgacccgagtcagcggcccagtcgtccgcc
gaagccggcgacggcgggtcggacgacggctcgagcgacggggagtcggattcggagacg
tcgcccgacgacgaggacgaggaaaccgcccagccgctcgtgcccggccagcagcgggct
ggggtcggcaaagcgcgggctcccgacctcgagtcgccgaccgtcgacagcgagacgccg
agcgcgaccggcacccgtgcgagtacgtcgccgagtacggccaaccggggcgctcgcgtg
cgcaccgaacccgcctcgggcgagggctcgatcgacgccgcggcgtcggtccggtcggcc
gccgcccgcggggcgtcccgcgtcggcgaggacgatttccggcagtcggtccggaccggc
gacacctcggtgacgatcgtcttcgccgtcgacgccagcgcctcgatgcggccggcgatg
cgcaccgcgaaaggtgtcgtgctcgaactcctgcgggacagctacgaacaccgcgatcaa
gtctcgttcgtcgcgttcgccggcgaggacgccgacgtcttgctcccgccgaccgacagc
gtctcgctggccgcccgtcatctcaaggacctcccctccggcgaccgaacgccgctgccg
gccggcctcgagacctcgcgccgagtgctcgagcgcgccgagaccgacgcctcggtcgtc
gtcctcgtcaccgacggccgggcgaacgtcgccgacgggagtccgacggcggcgacgcga
acggctgctcgagcgctcgcgaccagcgacgcccgcgtgatcgtggtcgacgcaggtgag
gactcccgggccggcctctcggaactagttgcgaccgaaaccgacggcgaactggtcgac
ctcgcttcgctgtcggtcgagaccgttcgcgccgccgccgagaccgctgcggacgagacc
cgagggtag

DBGET integrated database retrieval system