KEGG   Natrinema sp. J7-2: NJ7G_3666Help
Entry
NJ7G_3666         CDS       T02184                                 

Definition
(GenBank) Cellulase
Organism
nat  Natrinema sp. J7-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AFO58882
UniProt: I7BQ68
Position
complement(3175011..3176078)
Genome map
AA seq 355 aa AA seqDB search
MTTVPFDFDLLTELTETSGVPGYEDRVRELVVRELEDSVDRVRTDAMGNVVGTLEGERDY
SVAVAAHMDEIGFMVRHITESEDGYGFVELDALGGWDARVLKAQRVTIHADDGDIPAVIG
SPPPHTLDDDDREQPPTIEDIVLDPGLPYEDLAERVSPGDLVTMSQTTERVGETVTGKAL
DDRVCLCAMLEAARRLTDPQVTIHFCATVQEELGLRGARALGIDIDPDLAIALDVTVAND
IPGFDAGEHVTELGAGTAIKLKDSSVITNPKLHDRLQSLAEEAGIDHQFEILPAGSTDTA
GFQYTAGAKPVGALSIPTRYLHTVTETAHVDDIAATIDLLEAFLETESGEYEYTL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgttccgttcgatttcgatctgctgacggagctgacggagacgagtggcgtc
cccgggtacgaggaccgcgttcgcgaactcgtcgtccgggaactcgaggacagcgtcgac
cgcgtgcgaaccgatgcgatgggcaacgtcgtcggcaccctcgagggcgaacgcgactat
tcagtggccgtcgcggcccacatggacgagatcggctttatggttcgccacatcacggaa
tccgaggacggctacggattcgtcgaactcgacgcgctcggcggctgggacgcgcgggtg
ttgaaggcccagcgcgtaacgatccacgccgacgacggggacattccggcggttatcggg
tcgccgcccccgcacacgttagacgacgacgaccgcgagcagccccccaccatcgaggac
atcgtcctcgaccctggccttccctacgaggacctcgcggagcgcgtctcacccggcgac
ctcgtcacgatgtcccagacgaccgagcgcgtcggcgagacggtcaccggcaaggccctc
gacgatcgcgtctgtctgtgtgccatgctcgaggcggcccgccgattgacggacccgcag
gtaacgatccacttctgtgcgaccgttcaggaggagctcggtctgcggggcgctcgtgcg
ctgggcatcgacatcgaccccgacctggcgatcgcactcgacgtgacggtcgccaacgat
atccccggcttcgacgccggcgagcacgtcaccgaactcggcgcgggaaccgcgatcaaa
ctcaaagactcgagtgtcatcacgaacccgaaacttcacgaccgcctccagtcgctcgcc
gaggaggccgggatcgaccaccagttcgagatcctacccgccggcagtaccgacaccgcg
gggttccagtacaccgcgggcgcgaaacccgtcggcgcgctttcgatcccgacccggtat
ctccacaccgtaaccgagaccgcccacgtcgacgacatcgcggcgacgatcgacctgctc
gaggcgttcctcgaaaccgaaagcggcgagtacgagtacacgctttaa

DBGET integrated database retrieval system