KEGG   Natrinema sp. J7-2: NJ7G_3998Help
Entry
NJ7G_3998         CDS       T02184                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
nat  Natrinema sp. J7-2
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NJ7G_3998
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NJ7G_3998
Enzymes [BR:nat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     NJ7G_3998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3458367..3460292)
Genome map
AA seq 641 aa AA seqDB search
MTALGGFQDRVARIDLSDGEIAYESIDDEDAAKYIGARGLGVKYVFDQGPGVDPLGPDNL
LAFMNGPLSGTQVTMSGRIAVCTKSPLTGTVTDSHHGGWSGARLKWAGFDGLCFEGGADD
PVYAYVEDGSVELRDASHLWGAGVHETRDRLEEELEGSYGKNLSLMAIGPAGENGVKYAC
IINEDDRASGRGGTGCVMGSKNLKAVVIKSTTKMPKPADPETFKEGHQQAMQAIQESEVT
APNEGGLSMYGTNVLMNIGEEMDGLPTKNGQYTSTESMRDTEGVDIDAERVSGENVRENI
LVDEPTCHSCPVACKKEVEVTAMHKGEEMNVRTESYEYESAYALGPNSGHTDRDKIALML
ERCNDMGIDTIDGGNMMAMAMEMTDEGKLEGVGELEWGDTETMIEMIERIARREDEFADL
LAEGPRRVADRKDAHDNSLAVKGQTIAAYDPRCMKGMGIGYATSNRGACHLRGYTPAAEI
LGIPEKVDPYEYEGKGELTAQFQDLHAISDSFDICKFNAFAEGIEEYVLQYNGMTGRDVT
EEELLEAGERIYNLERYYNNLNGFDGSDDSLPARFLEDGIHGQGASEGEYCELAEMKDEY
YDHRGWVDGVVPDEKLDELGIELGPGTGVSSEGGAAASSDD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacagcactcggcggatttcaggacagggtcgcccgcatcgatctctcggacggggag
atcgcgtacgagtcgatcgacgacgaggacgcagcgaagtatatcggtgcgcgggggctc
ggggtaaagtacgtcttcgaccagggaccgggggtcgatccgctcggtcccgacaacctg
ttggcctttatgaatggcccgctgtcgggcacgcaggtgacgatgagcggtcggatcgcc
gtctgcacgaagtcgccgctgaccgggaccgtcaccgacagtcaccacggcggctggtcg
ggagcccggctcaagtgggccggcttcgacggactgtgcttcgagggcggggccgacgac
ccggtctacgcctacgtcgaggacgggtccgtcgaactccgggacgcctcccatctctgg
ggtgcgggtgtccacgagacgcgggaccgactcgaggaggaactcgaggggtcgtacggc
aagaacctctcgttgatggcgatcggacccgccggcgagaacggcgtcaagtacgcctgc
atcatcaacgaggacgaccgagcctcgggacggggcggcaccggctgcgtgatggggtcg
aagaacctcaaggcggtcgtcatcaaatcgactacgaagatgcccaagccggccgatccg
gagacgttcaaagaaggccaccagcaggcgatgcaggccatccaagagtcggaggtcacc
gcgcccaacgagggcggcctctcgatgtacgggacgaacgtcttgatgaacatcggcgag
gagatggacggcctcccgacgaaaaacggtcagtatacgtcgaccgaaagcatgcgcgac
acggagggcgtcgacatcgacgccgaacgcgtctccggcgagaacgtccgcgagaacatc
ctcgtcgacgagccgacctgtcactcctgtccggtcgcctgcaagaaggaagtcgaggtg
accgcgatgcacaaaggcgaggagatgaacgtccggaccgagtcctacgagtacgagtcg
gcgtacgcgctcggcccgaactccggccacaccgaccgcgacaagatcgcgctcatgctc
gagcgctgtaacgacatgggcatcgacaccatcgacgggggcaacatgatggcgatggcc
atggaaatgaccgacgagggcaaactcgagggcgtcggcgaactcgagtggggcgacacc
gagaccatgatcgagatgatcgagcggatcgcccgccgcgaggacgagttcgcggacctg
ttggccgagggcccgcgccgcgtcgccgaccgcaaggacgcccacgacaactcgctggca
gtcaagggtcagaccatcgcggcctacgacccgcgctgtatgaaggggatgggcatcggc
tacgccacctcgaaccgcggggcctgccacctgcgcgggtacacccccgccgccgaaatc
ctcgggatcccggaaaaggtcgacccttacgagtacgaggggaaaggcgaactcaccgct
cagttccaggacctccacgccatcagcgactcgttcgacatctgcaagttcaacgccttc
gcggagggcatcgaggagtacgtcctgcagtacaacggcatgactggccgcgatgtcacc
gaggaggaactgctcgaggccggcgaacggatctacaacttggagcggtactacaacaac
ctcaacggcttcgacgggagcgacgactcgctgccagcgcgcttcctcgaagacggtatc
cacggtcagggtgccagcgagggcgagtactgcgaactcgccgagatgaaagacgagtac
tacgaccaccgcggctgggtcgacggcgtcgtccctgacgaaaaactcgacgaactcgga
atcgaactcgggccggggacgggcgtcagcagcgagggcggtgcggccgcatcgagcgac
gactga

DBGET integrated database retrieval system