KEGG   Natrinema sp. J7-2: NJ7G_4131Help
Entry
NJ7G_4131         CDS       T02184                                 

Definition
Indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nat  Natrinema sp. J7-2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NJ7G_4131
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NJ7G_4131
Enzymes [BR:nat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NJ7G_4131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3570926..3571762
Genome map
AA seq 278 aa AA seqDB search
MNSDTELAPAVQSILAAARERAGGEGVVDVDARSLADALADAEADGRVPLIAEVKPTSPT
AEGTRDDDPVELARAMVAGGAAAISVLTEPSHFGGSPEALTRIREAVDVPVLRKDFIVDE
SGMDLVEADLLLLIVRFVDDLEALVAAARERGFQPLVEVHDRDELETALEAGADLIGVNN
RDLATLEVDLETVESVAPNVPEDVTLIAESGVSSPGDVRRMREADADALLVGSAIMGHGG
DSDVTENTRRLVRAESMDAADLATASATTTAHDGDSQT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgatacggagctcgcccccgcggtgcagtcgatactcgcggccgcacgggag
cgtgccggcggtgagggcgtcgtcgacgtggacgcgcgctcgctggccgatgcgctggcc
gacgccgaggccgacgggcgagtgccactgatcgcggaggtgaaaccgacgagtccgacg
gccgaggggactcgagacgacgatccggtcgaactggctcgagcgatggtcgcgggcggc
gcggcggcgatttcggtgctaacggagccgagccacttcggcggctcgcccgaggcgctg
actcggattcgggaggccgtcgacgtcccggtcctgcggaaggacttcatcgtcgatgag
agcggcatggacctcgtcgaagcggacctgctcctgttgatcgtcaggttcgtcgacgat
ctcgaggccctcgtggcggccgcccgcgagcgcgggttccagcccctcgtggaggtccac
gaccgggacgaactcgagaccgccctcgaagcgggtgccgacctgatcggggtgaacaac
cgcgatctggcgactctcgaggtcgatctcgaaaccgtcgagtcggtcgcacccaacgtc
cccgaggacgtaacgctgatcgccgagagcggagtgtcgtcgccgggcgacgtccggcgg
atgcgggaggcggatgccgacgccttgctggtcggcagcgccatcatgggccacggcggc
gacagcgacgtgaccgagaacacgcgacggctcgttcgagcggaatcgatggatgccgcg
gacttggcaacggcgtccgcgacgacgacagcacacgacggagacagccagacatga

DBGET integrated database retrieval system