KEGG   Natrinema sp. J7-2: NJ7G_4132Help
Entry
NJ7G_4132         CDS       T02184                                 

Definition
tryptophan synthase, beta subunit
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nat01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nat00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nat00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3571759..3573078
Genome map
AA seq 439 aa AA seqDB search
MSMEREHDDESASGRTGMFGDYGGQYVPEALMPALQELEDAYERYVLENEDGFMDEFRER
LRDFGGRPTPLQRADRLSERYDRDIYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIA
ETGAGQHGTATAMAAAHLDMPCEIYMGRTDVNRQRPNVYRMRMNGAEVNPVEAGSGTLKE
AINETMRDWATTVERTHYVIGSVVGPHPFPKMVRDFQAVIGDETRTQIRETAGRLPDSVI
ACAGGGSNTMGTFHAFVPDDEVALYAVEAGGSSLEIDEDAGLAPNSATLSTGTDGVLHGA
MTKLLQGTDGQIVESHSVSAGLDYAGVGPELSYLVETGRVVPATVDDDAALDGFHRLSRL
EGIIPALESSHALGYLERAAGPAGETAGGHRPRDEGHGDLGDLVVVTVSGRGDKDLETVL
EETETRDLEAAPDVEVFDG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggaacgcgaacacgacgatgagagtgcatccgggcggaccgggatgttcggc
gactacggcggccagtacgttcccgaggcattgatgcccgccctgcaggaactcgaggac
gcctacgagcggtacgttctggagaacgaggacggcttcatggacgagttccgggagcga
ttgcgcgatttcggcgggcggccgacgccactccagcgtgcggatcgcctgagcgagcgc
tacgaccgcgacatctacctcaaacgcgaggacctcctccacggcggggcccacaagctc
aacaacgcgctcggacaggttcttctcgcgaaatacatgggtaaagagcggatcatcgcc
gagaccggggccggccagcacggcaccgcgacggcgatggccgcagcccacctcgacatg
ccctgcgagatctatatgggtcgaacggatgtcaatcgccagcgccccaacgtctaccgc
atgcgaatgaacggggccgaggtaaaccccgtcgaggccggcagcgggacgttgaaggag
gcgatcaacgaaacgatgcgcgactgggcgacgaccgtcgagcgaacccactacgtgatc
ggctcggtcgtcggcccgcacccgttcccgaagatggtccgggacttccaggcagtcatc
ggcgacgaaacgcgaacgcagatccgggagacggcgggccggctccccgacagcgtcatc
gcctgcgccggcggcggctcgaatacgatggggacgttccacgccttcgttcccgacgac
gaggtcgccctctacgccgtcgaggccggcggctcgagcctcgagatcgacgaggacgcg
ggtctggcaccgaactccgccacgctctcgacgggaaccgacggggtgcttcacggcgcg
atgacgaagctcctccagggaaccgacggccagatcgtcgaatcccacagcgtcagcgcc
ggcctcgactatgccggcgttgggccggagctgtcgtatctcgtcgagacggggcgagtc
gtgcccgctaccgtcgacgacgacgccgcgctcgacggctttcaccgtctctcgcggctt
gagggcatcattccggcgctcgaatcgagtcacgcgctgggctatctcgagcgcgcggcg
ggacccgccggggagaccgcaggcgggcaccggccgcgagacgagggccacggggacctc
ggcgacctcgtcgtcgtcaccgtctccgggcgtggggacaaggacctcgagaccgtcctc
gaggaaaccgagacccgcgatctcgaggccgcgccggacgtggaggtgttcgacgggtga

DBGET integrated database retrieval system