KEGG   Natrinema sp. J7-2: NJ7G_4133Help
Entry
NJ7G_4133         CDS       T02184                                 

Definition
Tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nat  Natrinema sp. J7-2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NJ7G_4133
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NJ7G_4133
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NJ7G_4133
Enzymes [BR:nat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NJ7G_4133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3573075..3573980
Genome map
AA seq 301 aa AA seqDB search
MTDAGRSTASGYDSDIEAAIREHHPALITYITAGDPSLADTKAYVEALDRGGADLIELGL
PFSEPVAEGATIQAAINRALEAGTTPEGFFELVADLETEAPLLVMTYYNMLLQYGAEPDV
RPFVERAAEAGLSGIIVPDLPAEEADPLRAACDDTGLDLVFIIAPTTEGERLDRIMSHVS
GFAYVQARLGTTGARANVSGATHDSLARLSEYDVPKAVGFGVSEGDHAAEIIDAGADGVI
VGSALVDIIAAHSPAGSETASRSVASSAAPGDAAAALEAKAEELKRGARRGADSITDDHD
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacgccggacggtcgacggcgagcgggtacgacagcgacatcgaagcagccatc
agggagcaccaccccgcgctcatcacctacattacggcgggcgatccctcgctcgcggac
acgaaggcgtacgtcgaagcactcgaccggggcggtgcggacctgatcgaactcggcctc
ccgttctcggaaccggtcgcggagggagcgacgatccaggccgcgatcaatcgtgcgctc
gaggccggcacgacccctgagggcttcttcgagttggtcgccgacctcgagacagaggca
ccgctgctggtgatgacgtactacaacatgctcctccagtacggtgccgaacccgacgtg
cgaccgttcgtcgagcgcgccgccgaggccggtctctcggggatcatcgtccccgacctg
cccgccgaggaggccgatccgctgcgggcggcctgcgacgacaccgggctcgatctcgtc
ttcatcatcgcgccgacgaccgagggcgagcgcctggatcggatcatgtctcacgtgtcg
ggcttcgcctacgtccaggcgcgtctcgggacgacgggcgcacgcgcaaacgtctcgggg
gcgacccacgacagcctcgcgcggctctcggagtacgacgtccccaaagccgtcggcttc
ggcgtcagcgagggcgaccacgcggccgaaatcatcgatgccggcgcggacggcgtcatc
gtcgggagcgccctggtcgatatcatcgctgcccacagcccagcgggctccgagacggcg
tcccgaagtgtcgcctcgagcgcggcacccggcgacgcggccgccgcactcgaggccaaa
gccgaggaactcaaacgcggcgcacgtcgcggtgcagacagtatcacggacgatcacgac
gaatga

DBGET integrated database retrieval system